| Clone Name | baet49d11 |
|---|---|
| Clone Library Name | barley_pub |
>STAT1_PIG (Q764M5) Signal transducer and activator of transcription 1| Length = 757 Score = 31.6 bits (70), Expect = 0.95 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -3 Query: 385 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 278 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 693 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 727
>STAT1_HUMAN (P42224) Signal transducer and activator of transcription| 1-alpha/beta (Transcription factor ISGF-3 components p91/p84) Length = 750 Score = 31.6 bits (70), Expect = 0.95 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -3 Query: 385 LPGPVGQGYILVEYISVARVRPRTSKGITDLLLPQT 278 L GP G GYI E ISV+ V P + TD LLP + Sbjct: 693 LDGPKGTGYIKTELISVSEVHPSRLQ-TTDNLLPMS 727
>DPOLZ_MOUSE (Q61493) DNA polymerase zeta catalytic subunit (EC 2.7.7.7)| (Seizure-related protein 4) Length = 3122 Score = 30.0 bits (66), Expect = 2.8 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = -2 Query: 173 QTNRSTN*ERPCTTTHRIKKELSVCQSLLCLDLVSFPVLSQIKPQAPRLVVPFRQ 9 Q +STN + T+TH+ K +SV + + PV S KP+ PR P Q Sbjct: 1537 QKAQSTNVVQDSTSTHQPDKNISVSNEHKKANKRTRPVTSPRKPRTPRRTKPKEQ 1591
>MPD2_YEAST (Q99316) Protein disulfide isomerase MPD2 precursor (EC 5.3.4.1)| Length = 277 Score = 29.6 bits (65), Expect = 3.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 89 LCLDLVSFPVLSQIKPQAPRLVVP 18 LC DL FP++ +KP+ LV+P Sbjct: 98 LCTDLPGFPIIELVKPRTKPLVLP 121
>PE2R4_HUMAN (P35408) Prostaglandin E2 receptor, EP4 subtype (Prostanoid EP4| receptor) (PGE receptor, EP4 subtype) Length = 488 Score = 28.5 bits (62), Expect = 8.1 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +1 Query: 199 SAC*LAMRSHPSAASFLEGLSPFRRRK-FEAITG 297 +A +A R HP+A+ L LS FRRR+ F I G Sbjct: 232 AAASVASRGHPAASPALPRLSDFRRRRSFRRIAG 265 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,766,694 Number of Sequences: 219361 Number of extensions: 1299473 Number of successful extensions: 2580 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2580 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)