| Clone Name | baet49c11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CHLP_SYNY3 (Q55087) Geranylgeranyl hydrogenase | 49 | 3e-06 | 2 | DBP1_YEAST (P24784) ATP-dependent RNA helicase DBP1 (EC 3.6.1.-)... | 30 | 2.3 | 3 | RBY1A_HUMAN (Q15414) RNA-binding motif protein, Y chromosome, fa... | 28 | 5.2 | 4 | CD97_HUMAN (P48960) CD97 antigen precursor (Leukocyte antigen CD97) | 28 | 5.2 |
|---|
>CHLP_SYNY3 (Q55087) Geranylgeranyl hydrogenase| Length = 407 Score = 49.3 bits (116), Expect = 3e-06 Identities = 26/55 (47%), Positives = 34/55 (61%) Frame = +1 Query: 1 RREVLDDFLRTRAQKAGAEVLNGLFLRYEEPKERNGTYTVHYNHYDSSNGKVGGE 165 RREVLD FLR RA+K G +V+NG + + P + + YT+HY D S G GE Sbjct: 93 RREVLDGFLRERAEKLGTKVINGTVYKLDIPSKDSDPYTLHY--ADHSVGGTTGE 145
>DBP1_YEAST (P24784) ATP-dependent RNA helicase DBP1 (EC 3.6.1.-) (DEAD box| protein 1) (Helicase CA1) Length = 617 Score = 29.6 bits (65), Expect = 2.3 Identities = 19/50 (38%), Positives = 25/50 (50%) Frame = +1 Query: 19 DFLRTRAQKAGAEVLNGLFLRYEEPKERNGTYTVHYNHYDSSNGKVGGEK 168 DF R ++ G NG F + KERNG + +YN SSN K G + Sbjct: 55 DFFRRAGRQTGN---NGGFFGFS--KERNGGTSANYNRGGSSNYKSSGNR 99
>RBY1A_HUMAN (Q15414) RNA-binding motif protein, Y chromosome, family 1 member| A1 (RNA-binding motif protein 1) Length = 496 Score = 28.5 bits (62), Expect = 5.2 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +3 Query: 9 GARRLPPYPRAEGRRRGPQWSLPKVRGAQGAQR 107 G RR PP A R R P SL RG++G R Sbjct: 91 GGRRRPP---ASSRNRSPSGSLRSARGSRGGTR 120
>CD97_HUMAN (P48960) CD97 antigen precursor (Leukocyte antigen CD97)| Length = 835 Score = 28.5 bits (62), Expect = 5.2 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 61 LNGLFLRYEEPKERNGTYTVHYNHYDSSNGKVG 159 +N +FL + KE N ++H +SS+G+ G Sbjct: 445 VNSIFLSHNNTKELNSPILFAFSHLESSDGEAG 477 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,635,196 Number of Sequences: 219361 Number of extensions: 263756 Number of successful extensions: 796 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 796 length of database: 80,573,946 effective HSP length: 31 effective length of database: 73,773,755 effective search space used: 1770570120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)