| Clone Name | baet48f11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NASP_RABIT (P27123) Nuclear autoantigenic sperm protein (NASP) | 31 | 0.62 | 2 | GSP_CRIFA (P90518) Glutathionylspermidine synthase (EC 6.3.1.8) | 28 | 6.8 | 3 | GLNE_NOCFA (Q5YZ84) Glutamate-ammonia-ligase adenylyltransferase... | 27 | 8.9 |
|---|
>NASP_RABIT (P27123) Nuclear autoantigenic sperm protein (NASP)| Length = 680 Score = 31.2 bits (69), Expect = 0.62 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -3 Query: 104 VRGEQLRKSDAPPNEASPLMPTDAARVGDGQRER 3 V +QL D PP E SP++ T+AA VG E+ Sbjct: 227 VLNQQLVGQDVPPVEESPMVTTEAAEVGSEVSEK 260
>GSP_CRIFA (P90518) Glutathionylspermidine synthase (EC 6.3.1.8)| Length = 719 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -3 Query: 107 CVRGEQLRKSDAPPNEASPL-MPTDAARVGDGQRE 6 CV+ R D PP+ A+PL P D + DG+ E Sbjct: 454 CVKLVNFRYRDGPPSNAAPLATPCDHPTIVDGEDE 488
>GLNE_NOCFA (Q5YZ84) Glutamate-ammonia-ligase adenylyltransferase (EC 2.7.7.42)| ([Glutamate--ammonia-ligase] adenylyltransferase) (Glutamine-synthetase adenylyltransferase) (ATase) Length = 1004 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 45 HQWRRLVRWRVALP*LLPPHTRASDSDDSALSWCAR 152 +++ RL+ R+ L L HT +D D+ + W AR Sbjct: 422 YEFLRLLEHRLQLQRLKRTHTLPADDDEEGMRWLAR 457 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,752,778 Number of Sequences: 219361 Number of extensions: 700484 Number of successful extensions: 1968 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1940 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1968 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)