| Clone Name | baet48f07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATM_DEBHA (Q6BV76) Serine/threonine-protein kinase TEL1 (EC 2.7.... | 29 | 3.8 | 2 | KSP1_YEAST (P38691) Serine/threonine-protein kinase KSP1 (EC 2.7... | 29 | 3.8 | 3 | AVT3_YEAST (P36062) Vacuolar amino acid transporter 3 | 28 | 8.6 |
|---|
>ATM_DEBHA (Q6BV76) Serine/threonine-protein kinase TEL1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase TEL1) (Telomere length regulation protein 1) (ATM homolog) Length = 2948 Score = 28.9 bits (63), Expect = 3.8 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +3 Query: 36 DQARSHSFLAHFTSSSLMSSCFEASAMADLIPGLPEEVARECLIRV 173 D ++ + ++S L+S+ +E+ DLI GLPEE + E I + Sbjct: 1919 DVSKHEKHIDWLSNSRLLSNIYESIDNEDLIFGLPEETSLEYAINM 1964
>KSP1_YEAST (P38691) Serine/threonine-protein kinase KSP1 (EC 2.7.11.1)| Length = 1029 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -3 Query: 202 RRTAGSWSNPTRMRHSLATSSGNPGIRSAIADASKQLL 89 RR++ + SNP M +L S +PG +S+ K LL Sbjct: 881 RRSSANESNPLHMNKALEKLSSSPGAKSSFVGFPKPLL 918
>AVT3_YEAST (P36062) Vacuolar amino acid transporter 3| Length = 692 Score = 27.7 bits (60), Expect = 8.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 179 EPHPYEALPRHLLRQPRNQV 120 EPH +A+ RHL+R P N + Sbjct: 103 EPHVVDAVARHLIRNPSNSL 122 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,395,269 Number of Sequences: 219361 Number of extensions: 356985 Number of successful extensions: 1241 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1241 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)