| Clone Name | baet48f02 |
|---|---|
| Clone Library Name | barley_pub |
>XTH25_ARATH (Q38907) Probable xyloglucan endotransglucosylase/hydrolase protein| 25 precursor (EC 2.4.1.207) (At-XTH25) (XTH-25) Length = 284 Score = 37.0 bits (84), Expect = 0.014 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +2 Query: 152 FDKEFDVTWGDGRGKI 199 FD EFD+TWGDGRGK+ Sbjct: 30 FDTEFDITWGDGRGKV 45
>XTH16_ARATH (Q8LG58) Probable xyloglucan endotransglucosylase/hydrolase protein| 16 precursor (EC 2.4.1.207) (At-XTH16) (XTH-16) Length = 291 Score = 30.8 bits (68), Expect = 1.0 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = +2 Query: 152 FDKEFDVTWGDGRGKI 199 F++EFD+TWG+ RGKI Sbjct: 27 FNEEFDLTWGEHRGKI 42
>XTH21_ARATH (Q9ZV40) Probable xyloglucan endotransglucosylase/hydrolase protein| 21 precursor (EC 2.4.1.207) (At-XTH21) (XTH-21) Length = 305 Score = 30.8 bits (68), Expect = 1.0 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +2 Query: 152 FDKEFDVTWGDGRGKI 199 F+++ D+TWGDGRG I Sbjct: 28 FNQDIDITWGDGRGNI 43
>XTH15_ARATH (Q38911) Probable xyloglucan endotransglucosylase/hydrolase protein| 15 precursor (EC 2.4.1.207) (At-XTH15) (XTH-15) Length = 289 Score = 30.0 bits (66), Expect = 1.7 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +2 Query: 152 FDKEFDVTWGDGRGKI 199 F EFD+TWGD RGKI Sbjct: 28 FFDEFDLTWGDHRGKI 43
>ITIH4_HUMAN (Q14624) Inter-alpha-trypsin inhibitor heavy chain H4 precursor| (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120 Length = 930 Score = 30.0 bits (66), Expect = 1.7 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = -3 Query: 198 ILPRPSPQVTSN---SLSKLAAARAQEASRIESTDAPMRAMRCVLPKVG 61 ILP +P TSN ++S++ + +E + T AP++A +LP G Sbjct: 692 ILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPG 740
>XTH22_ARATH (Q38857) Xyloglucan endotransglucosylase/hydrolase protein 22| precursor (EC 2.4.1.207) (At-XTH22) (XTH-22) (Touch protein 4) Length = 284 Score = 29.3 bits (64), Expect = 3.0 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = +2 Query: 152 FDKEFDVTWGDGRGKI 199 F ++ ++TWGDGRG+I Sbjct: 23 FQRDVEITWGDGRGQI 38
>XTH23_ARATH (Q38910) Probable xyloglucan endotransglucosylase/hydrolase protein| 23 precursor (EC 2.4.1.207) (At-XTH23) (XTH-23) Length = 286 Score = 29.3 bits (64), Expect = 3.0 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = +2 Query: 152 FDKEFDVTWGDGRGKI 199 F ++ ++TWGDGRG+I Sbjct: 26 FQRDVEITWGDGRGQI 41
>YCG3_YEAST (P25591) Hypothetical 47.8 kDa protein in CHA1-KRR1 intergenic| region Length = 423 Score = 28.9 bits (63), Expect = 3.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 11 KKLNKHKFPSSILRPSEPTFGST 79 K LN F +S RPS PTFG++ Sbjct: 282 KSLNLGSFSASFFRPSNPTFGTS 304
>XTH20_ARATH (Q9FI31) Probable xyloglucan endotransglucosylase/hydrolase protein| 20 precursor (EC 2.4.1.207) (At-XTH20) (XTH-20) Length = 282 Score = 28.1 bits (61), Expect = 6.6 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 152 FDKEFDVTWGDGRGKI 199 F K+ + WGDGRGKI Sbjct: 29 FHKDVQIHWGDGRGKI 44
>XTH17_ARATH (O80803) Probable xyloglucan endotransglucosylase/hydrolase protein| 17 precursor (EC 2.4.1.207) (At-XTH17) (XTH-17) Length = 282 Score = 28.1 bits (61), Expect = 6.6 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 152 FDKEFDVTWGDGRGKI 199 F K+ + WGDGRGKI Sbjct: 29 FHKDVQIHWGDGRGKI 44
>XTH19_ARATH (Q9M0D1) Probable xyloglucan endotransglucosylase/hydrolase protein| 19 precursor (EC 2.4.1.207) (At-XTH19) (XTH-19) Length = 277 Score = 27.7 bits (60), Expect = 8.6 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 152 FDKEFDVTWGDGRGKI 199 F K+ + WGDGRGKI Sbjct: 24 FHKDVKIHWGDGRGKI 39
>XE7_HUMAN (Q02040) B-lymphocyte antigen precursor (B-lymphocyte surface| antigen) (721P) (Protein XE7) Length = 695 Score = 27.7 bits (60), Expect = 8.6 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 5/42 (11%) Frame = -2 Query: 154 EASRRQGARGEQD---RKHRRPHASHALR--APKSRLTRSEN 44 E SR + A +D RK RRPH HA + +P+ R T ++ Sbjct: 602 ERSRARRASSREDGRPRKERRPHKKHAYKDDSPRRRSTSPDH 643
>XTH18_ARATH (Q9M0D2) Probable xyloglucan endotransglucosylase/hydrolase protein| 18 precursor (EC 2.4.1.207) (At-XTH18) (XTH-18) Length = 282 Score = 27.7 bits (60), Expect = 8.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 152 FDKEFDVTWGDGRGKI 199 F K+ + WGDGRGK+ Sbjct: 29 FHKDVQIHWGDGRGKV 44
>EVC_MOUSE (P57680) Ellis-van Creveld syndrome protein homolog| Length = 1005 Score = 27.7 bits (60), Expect = 8.6 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Frame = -3 Query: 183 SPQVTSNSLSKLAAARAQEASRIESTDAPMRAMRCVLPKVGS----LGLRMLDGNLCLLS 16 SP + SLS+ +S + ST + R ++C +VGS L +D +LC+ S Sbjct: 156 SPASSLGSLSQAGKEDGSSSSSMRSTYSDDRILQCAFLRVGSFPEILACESVDIDLCVCS 215 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,865,047 Number of Sequences: 219361 Number of extensions: 421980 Number of successful extensions: 1873 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1871 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)