| Clone Name | baet48c03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYI_THIDA (Q3SHS3) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 28 | 5.1 | 2 | FAS_MOUSE (P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: ... | 28 | 8.8 | 3 | ANK3_HUMAN (Q12955) Ankyrin-3 (ANK-3) (Ankyrin-G) | 28 | 8.8 | 4 | FRIZ2_DROME (Q9VVX3) Protein frizzled-2 precursor (dFz2) | 28 | 8.8 | 5 | FAS_RAT (P12785) Fatty acid synthase (EC 2.3.1.85) [Includes: [A... | 28 | 8.8 |
|---|
>SYI_THIDA (Q3SHS3) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 929 Score = 28.5 bits (62), Expect = 5.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -2 Query: 182 LDGVPLPHPEAGEQASTTVGEESTSMARTSSAET 81 L+G+PL HP Q VGE T+ A T + T Sbjct: 299 LEGLPLWHPFQDRQVPVIVGEHVTADAGTGAVHT 332
>FAS_MOUSE (P19096) Fatty acid synthase (EC 2.3.1.85) [Includes:| [Acyl-carrier-protein] S-acetyltransferase (EC 2.3.1.38); [Acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39); 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41); 3-oxoacyl-[acyl- Length = 2504 Score = 27.7 bits (60), Expect = 8.8 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = -2 Query: 164 PHPEAGEQASTTVGEES--TSMARTSSAETFVDSIAATTC---ELWRSTESAL 21 P P + ST++ E +S+ARTSSAE V+++ + LW E A+ Sbjct: 705 PRPRSARWLSTSIPEAQWQSSLARTSSAEYNVNNLVSPVLFQEALWHIPEHAV 757
>ANK3_HUMAN (Q12955) Ankyrin-3 (ANK-3) (Ankyrin-G)| Length = 4377 Score = 27.7 bits (60), Expect = 8.8 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -2 Query: 182 LDGVPLPHPEAGEQASTTVGEESTSMARTSSAETFVD 72 + G P P PE E++ +STS+ +T+ ET V+ Sbjct: 3193 IPGKPSPIPEVSEESEEEEQAKSTSLKQTTVEETAVE 3229
>FRIZ2_DROME (Q9VVX3) Protein frizzled-2 precursor (dFz2)| Length = 694 Score = 27.7 bits (60), Expect = 8.8 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -2 Query: 170 PLPHPEAGEQASTTVGEESTSMARTSSAETFVDSIAATT 54 P+PHP AG VG + S+ T + S+A+T+ Sbjct: 639 PIPHPYAGSGMGMPVGSAAGSLLATPYTQAGGASVASTS 677
>FAS_RAT (P12785) Fatty acid synthase (EC 2.3.1.85) [Includes:| [Acyl-carrier-protein] S-acetyltransferase (EC 2.3.1.38); [Acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39); 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41); 3-oxoacyl-[acyl-ca Length = 2505 Score = 27.7 bits (60), Expect = 8.8 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = -2 Query: 164 PHPEAGEQASTTVGEES--TSMARTSSAETFVDSIAATTC---ELWRSTESAL 21 P P + ST++ E +S+ARTSSAE V+++ + LW E A+ Sbjct: 705 PRPRSARWLSTSIPEAQWQSSLARTSSAEYNVNNLVSPVLFQEALWHVPEHAV 757 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.304 0.115 0.319 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,350,371 Number of Sequences: 219361 Number of extensions: 241606 Number of successful extensions: 579 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (22.0 bits)