ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet45d02 |
|---|---|
| Clone Library Name | barley_pub |
>DAPF_SYNY3 (P74667) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 279 Score = 38.5 bits (88), Expect = 0.004 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = +1 Query: 253 ALHFVKYQGLGNDFIMVDNRDS 318 AL F KY GLGNDFI+VDNR S Sbjct: 2 ALSFSKYHGLGNDFILVDNRQS 23
>DAPF2_ANASP (Q8YVD0) Diaminopimelate epimerase 2 (EC 5.1.1.7) (DAP epimerase 2)| Length = 279 Score = 37.7 bits (86), Expect = 0.007 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = +1 Query: 253 ALHFVKYQGLGNDFIMVDNRDS 318 A+ F KY GLGNDFI++DNR S Sbjct: 2 AIEFTKYHGLGNDFILIDNRAS 23
>DAPF_SYNEL (Q8DGM2) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 286 Score = 36.6 bits (83), Expect = 0.016 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = +1 Query: 253 ALHFVKYQGLGNDFIMVDNR 312 +L F KYQGLGNDF+++DNR Sbjct: 2 SLSFQKYQGLGNDFLLIDNR 21
>DAPF_XYLFT (Q87DI4) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 284 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 Query: 256 LHFVKYQGLGNDFIMVDNRD 315 LHF K QG GNDF+++D RD Sbjct: 10 LHFTKMQGAGNDFVVLDLRD 29
>DAPF_XYLFA (Q9PD98) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 284 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 Query: 256 LHFVKYQGLGNDFIMVDNRD 315 LHF K QG GNDF+++D RD Sbjct: 10 LHFTKMQGAGNDFVVLDLRD 29
>DAPF_RICPR (Q9ZDB7) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 270 Score = 32.7 bits (73), Expect = 0.23 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = +1 Query: 256 LHFVKYQGLGNDFIMVDNRDSA 321 ++FVK GLGNDF++V+ RD A Sbjct: 5 INFVKMHGLGNDFVIVNKRDLA 26
>DAPF_RICCN (Q92I41) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 270 Score = 32.0 bits (71), Expect = 0.40 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = +1 Query: 256 LHFVKYQGLGNDFIMVDNRD 315 ++FVK GLGNDF++V+ RD Sbjct: 5 INFVKMHGLGNDFVIVNKRD 24
>POLG_SVDVU (P13900) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A) (P2-3B); Core protein P2B (P2-5B); Core protein P2C (P2-X); C Length = 2184 Score = 31.2 bits (69), Expect = 0.68 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P+ A L+ +SE + K +G Sbjct: 1418 SVGATLEALFQGPPVYREIKISVAPETPPPPAVADLLKSVDSEAVREYCKEKG 1470
>POLG_SVDVH (P16604) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A) (P2-3B); Core protein P2B (P2-5B); Core protein P2C (P2-X); C Length = 2184 Score = 31.2 bits (69), Expect = 0.68 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P+ A L+ +SE + K +G Sbjct: 1418 SVGATLEALFQGPPVYREIKISVAPETPPPPAVADLLKSVDSEAVREYCKEKG 1470
>POLG_EC01F (O91734) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2183 Score = 30.8 bits (68), Expect = 0.89 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P+ A L+ +SE + K +G Sbjct: 1417 SVGATLEALFQGPPVYREIKISVAPETPPPPAIADLLKSVDSEAVREYCKEKG 1469
>POLG_CXB6S (Q9QL88) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2183 Score = 30.8 bits (68), Expect = 0.89 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P+ A L+ +SE + K +G Sbjct: 1417 SVGATLEALFQGPPVYREIKISVAPETPPPPAIADLLKSVDSEAVREYCKEKG 1469
>POLG_EC30B (Q9WN78) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2193 Score = 30.8 bits (68), Expect = 0.89 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P+ A L+ +SE + K +G Sbjct: 1427 SVGATLEALFQGPPVYREIKISVAPETPPPPAIADLLKSVDSEAVREYCKEKG 1479
>POLG_EC12T (Q66575) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2192 Score = 30.8 bits (68), Expect = 0.89 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P+ A L+ +SE + K +G Sbjct: 1426 SVGATLEALFQGPPVIREIKISVAPETPPPPAIADLLKSVDSEAVREYCKEKG 1478
>POLG_EC09B (Q66577) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2202 Score = 30.8 bits (68), Expect = 0.89 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P+ A L+ +SE + K +G Sbjct: 1436 SVGATLEALFQGPPVYREIKISVAPETPPPPAIADLLKSVDSEAVREYCKERG 1488
>POLG_EC11G (P29813) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2194 Score = 30.4 bits (67), Expect = 1.2 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P+ A L+ +SE + K +G Sbjct: 1428 SVGATLEALFQGPPIYREIKISVAPETPPPPAIADLLKSVDSEAVREYCKEKG 1480
>POLG_EC05N (Q9YLJ1) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2195 Score = 30.4 bits (67), Expect = 1.2 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P+ A L+ +SE + K +G Sbjct: 1429 SVGATLEALFQGPPLYREIKISVAPETPPPPAIADLLKSVDSEAVREYCKEKG 1481
>DAPF_AQUAE (O67693) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 279 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 256 LHFVKYQGLGNDFIMVDNRD 315 + F K QG GNDF+++D+RD Sbjct: 1 MEFWKLQGSGNDFVVIDDRD 20
>POLG_CXB1J (P08291) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2181 Score = 30.4 bits (67), Expect = 1.2 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P+ A L+ +SE + K +G Sbjct: 1415 SVGATLEALFQGPPIYREIKISIAPETPPPPAIADLLKSVDSEAVREYCKEKG 1467
>POLG_CXB3W (Q66282) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2184 Score = 30.0 bits (66), Expect = 1.5 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P A L+ +SE + K +G Sbjct: 1418 SVGATLEALFQGPPVYREIKISVAPETPPPPRIADLLKSVDSEAVREYCKEKG 1470
>POLG_CXB3N (P03313) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2184 Score = 30.0 bits (66), Expect = 1.5 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P+ A L+ +SE + K +G Sbjct: 1418 SVGTTLEALFQGPPVYREIKISVAPETPPPPAIADLLKSVDSEAVREYCKEKG 1470
>POLG_CXB4E (Q86887) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2182 Score = 29.6 bits (65), Expect = 2.0 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P+ A L +SE + K +G Sbjct: 1416 SVGATLEALFQGPPIYREIRISVAPETPPPPAIADLLRSVDSEAVREYCKEKG 1468
>POLG_EC09H (Q66849) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2192 Score = 29.6 bits (65), Expect = 2.0 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P+ A L+ +SE + K +G Sbjct: 1426 SVGTTLEALFQGPPIYREIKISVAPETPPPPAIADLLKSVDSEAVREYCKEKG 1478
>POLG_CXB2O (Q9YLG5) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2186 Score = 29.6 bits (65), Expect = 2.0 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P+ A L+ +SE + K +G Sbjct: 1420 SVGATLEALFQGPPIYREIKISVAPETPPPPAIADLLKSVDSEVVREYCKEKG 1472
>GUX1_NEUCR (P38676) Exoglucanase 1 precursor (EC 3.2.1.91)| (Exocellobiohydrolase 1) (1,4-beta-cellobiohydrolase) Length = 516 Score = 29.3 bits (64), Expect = 2.6 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +1 Query: 115 APSSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQGLG 285 +P SGG GTPPS + ++ S+ PS+ S A H+ + G+G Sbjct: 441 SPFSGGS-----SGTPPSNPSSSASPTSSTAKPSSTSTASNPSGTGAAHWAQCGGIG 492
>POLG_CXB5P (Q03053) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2184 Score = 29.3 bits (64), Expect = 2.6 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P+ A L+ +SE + + +G Sbjct: 1418 SVGATLEALFQGPPIYREIKISVAPDTPPPPAIADLLKSVDSEAVREYCREKG 1470
>POLG_CXA9 (P21404) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome- Length = 2200 Score = 28.9 bits (63), Expect = 3.4 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +1 Query: 121 SSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQG 279 S G L F+G P R S+A TP P A L+ +SE + K +G Sbjct: 1434 SVGATLEALFQGPPIYREIKISVAPETPPPPVIADLLKSVDSEDVREYCKEKG 1486
>ALB3_MAIZE (P10593) Albumin b-32 protein (EC 3.2.2.22) (Opaque-6 protein)| (rRNA N-glycosidase) Length = 303 Score = 28.5 bits (62), Expect = 4.4 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = -2 Query: 314 SLLSTIMKSLPRPWYLTKWRARSDSRRSR--NEAADGDLGVDTAIEATA 174 S T S R W + W AR D R R E DGD G +A A Sbjct: 126 SAAGTRTSSATRVWRPSPWAARDDQGRQRPGEEEEDGDTGGGGGADADA 174
>DAPF_VIBVY (Q7MQC1) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 276 Score = 28.5 bits (62), Expect = 4.4 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +1 Query: 259 HFVKYQGLGNDFIMVD 306 HF K GLGNDF++VD Sbjct: 4 HFSKMHGLGNDFMVVD 19
>DAPF_VIBVU (Q8DD81) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 276 Score = 28.5 bits (62), Expect = 4.4 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +1 Query: 259 HFVKYQGLGNDFIMVD 306 HF K GLGNDF++VD Sbjct: 4 HFSKMHGLGNDFMVVD 19
>DAPF_VIBPA (Q87KJ4) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 276 Score = 28.5 bits (62), Expect = 4.4 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +1 Query: 259 HFVKYQGLGNDFIMVD 306 HF K GLGNDF++VD Sbjct: 4 HFSKMHGLGNDFMVVD 19
>DAPF_VIBCH (Q9KVL6) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 276 Score = 28.5 bits (62), Expect = 4.4 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +1 Query: 259 HFVKYQGLGNDFIMVD 306 HF K GLGNDF++VD Sbjct: 4 HFSKMHGLGNDFMVVD 19
>DAPF_RALSO (Q8Y344) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 292 Score = 28.5 bits (62), Expect = 4.4 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 Query: 256 LHFVKYQGLGNDFIMVD 306 LHF K G GNDF+++D Sbjct: 3 LHFTKMHGAGNDFVVLD 19
>DAPF_LEIXX (Q6AE05) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 292 Score = 28.5 bits (62), Expect = 4.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 256 LHFVKYQGLGNDFIMVDNRDSAV 324 LHF K QG GNDF++ + D + Sbjct: 4 LHFTKGQGTGNDFVLYADPDGTL 26
>ERFB_EMENI (Q5B3W7) Palmitoyltransferase erf2 (EC 2.3.1.-) (DHHC cysteine-rich| domain-containing protein erf2) (Ras protein acyltransferase) Length = 601 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 151 RGTPPSRRAVASMAVSTPRSPSAASFLER 237 RG PP+R ++AS + T R S+AS L R Sbjct: 66 RGPPPARSSIASTSQITNRPGSSASRLSR 94
>NU214_HUMAN (P35658) Nuclear pore complex protein Nup214 (Nucleoporin Nup214)| (214 kDa nucleoporin) (CAN protein) Length = 2090 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 148 FRGTPPSRRAVASMAVSTPRSPSAASF 228 F PPS+ ++A ++P +PSAASF Sbjct: 520 FSFVPPSKASLAPTPAASPVAPSAASF 546
>CLK3_HUMAN (P49761) Dual specificity protein kinase CLK3 (EC 2.7.12.1)| (CDC-like kinase 3) Length = 490 Score = 27.3 bits (59), Expect = 9.8 Identities = 19/55 (34%), Positives = 25/55 (45%) Frame = +1 Query: 130 GRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHFVKYQGLGNDF 294 GRL P R PP RR S + S R P + ERR+S+ + G D+ Sbjct: 32 GRLRYPSRREPPPRR---SRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDY 83
>DAPF_BRAJA (Q89X45) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 291 Score = 27.3 bits (59), Expect = 9.8 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 262 FVKYQGLGNDFIMVDNRDS 318 F K G+GN+ ++VD RDS Sbjct: 9 FAKMNGIGNEIVVVDMRDS 27
>CPB3_CAEBR (Q6E3D5) Cytoplasmic polyadenylation element-binding protein 3| Length = 753 Score = 27.3 bits (59), Expect = 9.8 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +1 Query: 118 PSSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLER 237 PSS GRLL+ F PSR+ ++V P PS +F R Sbjct: 116 PSSAGRLLKKF---APSRKPTEKISVDEP--PSRFNFFGR 150
>ZDS_MAIZE (Q9ZTP4) Zeta-carotene desaturase, chloroplast precursor (EC| 1.14.99.30) (Carotene 7,8-desaturase) Length = 570 Score = 27.3 bits (59), Expect = 9.8 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 115 APSSGGRLLRPFRGTPPSRRAVASMAVSTPRSPS 216 AP+ R RP G P RRA A A ST SP+ Sbjct: 11 APALAPRRARPGTGLVPPRRASAVAARSTVTSPT 44
>AT10A_HUMAN (O60312) Probable phospholipid-transporting ATPase VA (EC 3.6.3.1)| (ATPVA) (Aminophospholipid translocase VA) Length = 1499 Score = 27.3 bits (59), Expect = 9.8 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +1 Query: 118 PSSGGRLLRPFRGTPPSRRAVASMAVSTPRSPSAASFLERRESERALHF 264 PSS G LLR A+AS S+ A+ + +ESER L + Sbjct: 645 PSSDGMLLRLEERLGQPTSAIASNGYSSQADNWASELAQEQESERELRY 693 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,290,672 Number of Sequences: 219361 Number of extensions: 309345 Number of successful extensions: 1525 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 1462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1525 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
