| Clone Name | baet41c11 |
|---|---|
| Clone Library Name | barley_pub |
>NEU1_CATCO (P15210) Isoticin-neurophysin IT 1 precursor [Contains: Isotocin| (IT); Neurophysin IT 1] Length = 154 Score = 29.3 bits (64), Expect = 2.5 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +2 Query: 188 SICQGCFH*SRTKVGGSKTIRYRPSLNHKRCRPGIGGCC 304 S+C C+ S +GG + I+ PS C PG G C Sbjct: 16 SVCSACYI-SNCPIGGKRAIQDSPSRQCMSCGPGDRGRC 53
>NEU2_CATCO (P15211) Isoticin-neurophysin IT 2 precursor [Contains: Isotocin| (IT); Neurophysin IT 2] Length = 148 Score = 28.5 bits (62), Expect = 4.3 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 188 SICQGCFH*SRTKVGGSKTIRYRPSLNHKRCRPGIGGCC 304 S+C C+ S +GG + ++ PS C PG G C Sbjct: 16 SVCSACYI-SNCPIGGKRAVQDLPSRQCMSCGPGDRGRC 53
>RGYR_SULSH (P74759) Reverse gyrase [Includes: Helicase (EC 3.6.1.-);| Topoisomerase (EC 5.99.1.3)] Length = 1166 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +1 Query: 133 YFIVRGEILGFMKDEQLRKHLPRMFSLIKNE 225 + I++GE + + K EQLR+ L SL+K++ Sbjct: 439 FSIIKGETINYQKLEQLRQELLYYISLVKDK 469
>WSB1_HUMAN (Q9Y6I7) WD repeat and SOCS box-containing protein 1 (WSB-1) (SOCS| box-containing WD protein SWiP-1) Length = 421 Score = 28.1 bits (61), Expect = 5.6 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 201 PWQMLSQLFVFHKSKNFTSDYEIRMP 124 PW Q F+ H +KN T+ +R+P Sbjct: 62 PWSQCLQNFLLHGTKNVTNSSSLRLP 87
>XPO1_RAT (Q80U96) Exportin-1 (Exp1) (Chromosome region maintenance 1 protein| homolog) Length = 1071 Score = 28.1 bits (61), Expect = 5.6 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = +1 Query: 127 HSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESW 231 H+++ G ++G D+ +++HL + L+ N+ W Sbjct: 631 HTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVW 665
>XPO1_MOUSE (Q6P5F9) Exportin-1 (Exp1) (Chromosome region maintenance 1 protein| homolog) Length = 1071 Score = 28.1 bits (61), Expect = 5.6 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = +1 Query: 127 HSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESW 231 H+++ G ++G D+ +++HL + L+ N+ W Sbjct: 631 HTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVW 665
>XPO1_HUMAN (O14980) Exportin-1 (Exp1) (Chromosome region maintenance 1 protein| homolog) Length = 1071 Score = 28.1 bits (61), Expect = 5.6 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = +1 Query: 127 HSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESW 231 H+++ G ++G D+ +++HL + L+ N+ W Sbjct: 631 HTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVW 665
>NEUI_FUGRU (O42493) Isoticin-neurophysin IT 1 precursor [Contains: Isotocin| (IT); Neurophysin IT 1] Length = 155 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +2 Query: 188 SICQGCFH*SRTKVGGSKTIRYRPSLNHKRCRPGIGGCCSAMG 316 S+C C+ S +GG ++I P C PG G C G Sbjct: 15 SVCSACYI-SNCPIGGKRSIMDAPQRKCMSCGPGDRGRCFGPG 56
>GTR3_BOVIN (P58352) Solute carrier family 2, facilitated glucose transporter| member 3 (Glucose transporter type 3, brain) Length = 494 Score = 27.7 bits (60), Expect = 7.3 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 6/40 (15%) Frame = +1 Query: 70 GPIVLAFGIGVMINRDSRGHSYFIVR------GEILGFMK 171 G ++ +F +G+ +NR RG+S IV G ++GF K Sbjct: 73 GGMIGSFSVGLFVNRFGRGNSMLIVNLLAIAGGCLMGFCK 112
>ATRN_RAT (Q99J86) Attractin precursor (Zitter protein)| Length = 1432 Score = 27.3 bits (59), Expect = 9.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 254 RPSLNHKRCRPGIGGCCSAMGESLTEQCR 340 RP +N RC PG G C G + EQC+ Sbjct: 106 RPCVNGGRCNPGTGQCVCPTG-WVGEQCQ 133
>ATRN_MOUSE (Q9WU60) Attractin precursor (Mahogany protein)| Length = 1428 Score = 27.3 bits (59), Expect = 9.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 254 RPSLNHKRCRPGIGGCCSAMGESLTEQCR 340 RP +N RC PG G C G + EQC+ Sbjct: 102 RPCVNGGRCNPGTGQCVCPTG-WVGEQCQ 129
>ATRN_HUMAN (O75882) Attractin precursor (Mahogany homolog) (DPPT-L)| Length = 1429 Score = 27.3 bits (59), Expect = 9.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 254 RPSLNHKRCRPGIGGCCSAMGESLTEQCR 340 RP +N RC PG G C G + EQC+ Sbjct: 103 RPCVNGGRCNPGTGQCVCPAG-WVGEQCQ 130
>EXTN3_ARATH (Q9FS16) Extensin-3 precursor (AtExt3) (AtExt5)| Length = 427 Score = 27.3 bits (59), Expect = 9.6 Identities = 20/75 (26%), Positives = 27/75 (36%) Frame = -2 Query: 315 PIAEQHPPIPGRHRLWLRLGRYLIVFEPPTFVLD**KHPWQMLSQLFVFHKSKNFTSDYE 136 P PP P +H Y+ PP P + S V+H Y Sbjct: 355 PPVYHSPPPPKKH--------YVYKSPPP---------PVKHYSPPPVYHSPPPPKEKYV 397 Query: 135 IRMPPTVPINHYSDP 91 + PP P++HYS P Sbjct: 398 YKSPPPPPVHHYSPP 412
>CAC1E_RABIT (Q02343) Voltage-dependent R-type calcium channel alpha-1E subunit| (Voltage-gated calcium channel alpha subunit Cav2.3) (Calcium channel, L type, alpha-1 polypeptide, isoform 6) (Brain calcium channel II) (BII) Length = 2259 Score = 27.3 bits (59), Expect = 9.6 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 12/49 (24%) Frame = +2 Query: 221 TKVGGSKTIRYRPSLNH------------KRCRPGIGGCCSAMGESLTE 331 T +G S TI P L H +R PG G C A+G+ L++ Sbjct: 2205 TSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGAGALCGAVGDLLSD 2253
>WBS14_CAEEL (P41846) WBSCR14 protein homolog (Mlx interactor)| Length = 1009 Score = 27.3 bits (59), Expect = 9.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 152 SPLTMKYECPRLSLLIITPIPKANTIGPES 63 SPLT + P L + TP+P AN GP++ Sbjct: 541 SPLTASVQSP---LSVATPLPLANQTGPQT 567
>RGYR2_SULSO (Q97ZF5) Reverse gyrase 2 [Includes: Helicase (EC 3.6.1.-);| Topoisomerase (EC 5.99.1.3)] Length = 1166 Score = 27.3 bits (59), Expect = 9.6 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +1 Query: 133 YFIVRGEILGFMKDEQLRKHLPRMFSLIKNE 225 + I++GE + + K EQLR+ L SL+K++ Sbjct: 439 FSIIKGESINYHKLEQLRQELLYYMSLVKDK 469
>NEU2_ONCKE (Q91167) Isoticin-neurophysin IT 2 precursor [Contains: Isotocin| (IT); Neurophysin IT 2] Length = 156 Score = 27.3 bits (59), Expect = 9.6 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +2 Query: 188 SICQGCFH*SRTKVGGSKTIRYRPSLNHKRCRPGIGGCC 304 S+C C+ S +GG ++I P C PG G C Sbjct: 15 SVCSACYI-SNCPIGGKRSIMDAPQRKCMSCGPGEQGRC 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,127,171 Number of Sequences: 219361 Number of extensions: 1083700 Number of successful extensions: 2355 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 2307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2355 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)