| Clone Name | baet40b12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CPR3_CAEEL (P43507) Cathepsin B-like cysteine proteinase 3 precu... | 30 | 3.0 |
|---|
>CPR3_CAEEL (P43507) Cathepsin B-like cysteine proteinase 3 precursor (EC| 3.4.22.-) (Cysteine protease-related 3) Length = 370 Score = 29.6 bits (65), Expect = 3.0 Identities = 12/40 (30%), Positives = 23/40 (57%), Gaps = 5/40 (12%) Frame = +2 Query: 158 YELGDADLAFRL-----HYLRGVYYYAAGEVVRGVTTKVL 262 Y G + ++++ HY GVY+Y +G++V G K++ Sbjct: 250 YHYGPVEASYKVYEDFYHYKSGVYHYTSGKLVGGHAVKII 289 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,879,305 Number of Sequences: 219361 Number of extensions: 285657 Number of successful extensions: 1119 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1119 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)