| Clone Name | baet39g11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EST_HEVBR (Q7Y1X1) Esterase precursor (EC 3.1.1.-) (Early nodule... | 58 | 5e-09 | 2 | FUCO2_ARATH (Q9FXE5) Alpha-L-fucosidase 2 precursor (EC 3.2.1.51... | 50 | 2e-06 | 3 | Y1546_METJA (Q58941) UPF0219 protein MJ1546 | 28 | 4.4 |
|---|
>EST_HEVBR (Q7Y1X1) Esterase precursor (EC 3.1.1.-) (Early nodule-specific| protein homolog) (Latex allergen Hev b 13) Length = 391 Score = 58.2 bits (139), Expect = 5e-09 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 222 FHRPTGRFCDGRLIIDFLCESLNISYLSPYLKALG 326 FHR TGR+ DGRLIIDF+ ES N+ YLSPYL +LG Sbjct: 64 FHRSTGRYSDGRLIIDFIAESFNLPYLSPYLSSLG 98
>FUCO2_ARATH (Q9FXE5) Alpha-L-fucosidase 2 precursor (EC 3.2.1.51)| (Alpha-L-fucoside fucohydrolase 2) (Alpha-1,2-fucosidase) (AtFXG1) Length = 372 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/35 (57%), Positives = 27/35 (77%) Frame = +3 Query: 222 FHRPTGRFCDGRLIIDFLCESLNISYLSPYLKALG 326 F P GR+CDGRL+IDF+ ESL + YLS +L ++G Sbjct: 60 FGSPAGRYCDGRLVIDFIAESLGLPYLSAFLDSVG 94
>Y1546_METJA (Q58941) UPF0219 protein MJ1546| Length = 345 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 189 GARPVVFNFGAFHRPTGRF-CDGRLIIDFLCESLNISYLSPYL 314 G +P +++ FH+P G+F I+ F E I L+PY+ Sbjct: 222 GTKPEDYDYCVFHQPNGKFYIRVAKILGFKEEQYKIGLLTPYI 264 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,775,505 Number of Sequences: 219361 Number of extensions: 252338 Number of successful extensions: 513 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)