ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet39a09 |
|---|---|
| Clone Library Name | barley_pub |
>PRA_MYCTU (O53426) Proline-rich antigen homolog| Length = 240 Score = 33.9 bits (76), Expect = 0.17 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = -3 Query: 145 PGPAGGFDPRAYAVDAMEDH---PPPDTRHGHDPRPIPPAG 32 PGP+GG +P A + PPP + G+ P P PP G Sbjct: 18 PGPSGGHEPPPAAPPGGSGYAPPPPPSSGSGYPPPPPPPGG 58
>TEGU_EBV (P03186) Large tegument protein| Length = 3149 Score = 33.1 bits (74), Expect = 0.29 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -3 Query: 148 SPGPAGGFDPRAYAVDAMEDHPPPDTRHGHDPRPIPPAGQR 26 +P PA P A ++ ++HPP R G + P PP GQ+ Sbjct: 603 APPPAQQLPPSATTLEPEKNHPPAADRAGTEISPSPPFGQQ 643
>YLS6_CAEEL (P34391) Putative cuticle collagen F09G8.6| Length = 278 Score = 30.4 bits (67), Expect = 1.9 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -3 Query: 166 SRGCLRSPGPAGGFDPRAYAVDAMEDHPPPDTRHGHDPRPIPPA 35 S G +PGPAG P P PD GHD +P P A Sbjct: 224 SAGAPGAPGPAGA--PGVDGQPGANGQPGPDGEQGHDGQPGPDA 265
>CO3A1_MOUSE (P08121) Collagen alpha-1(III) chain precursor| Length = 1464 Score = 30.4 bits (67), Expect = 1.9 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = -3 Query: 163 RGCLRSPGPAGGFDPRAYAVDAMEDHPPP--DTRHGHDPRPIPPAGQRKRRNK 11 +G + SPGPAG P + H PP D GH P PI P G R R + Sbjct: 1126 QGAIGSPGPAGPRGP-------VGPHGPPGKDGTSGH-PGPIGPPGPRGNRGE 1170
>CO3A1_RAT (P13941) Collagen alpha-1(III) chain precursor| Length = 1463 Score = 30.0 bits (66), Expect = 2.4 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = -3 Query: 163 RGCLRSPGPAGGFDPRAYAVDAMEDHPPP--DTRHGHDPRPIPPAGQRKRRNK 11 +G + SPGPAG P + H PP D GH P PI P G R R + Sbjct: 1126 QGAVGSPGPAGPRGP-------VGPHGPPGKDGSSGH-PGPIGPPGPRGNRGE 1170
>Y1491_HELPY (O26024) Putative phosphate permease HP1491| Length = 533 Score = 29.6 bits (65), Expect = 3.2 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +3 Query: 165 LAKELSRIEPKKLGIWLVAGCCLALLTYISFARLFAIYSPVFEST 299 + K L R+ I L GC LALL +I F R +P E++ Sbjct: 238 IVKVLKRLYALNFEIQLACGCILALLIFILFKRFVLKKAPQLENS 282
>CWC22_CRYNE (Q5KFX4) Pre-mRNA-splicing factor CWC22| Length = 831 Score = 29.3 bits (64), Expect = 4.1 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -3 Query: 151 RSPGPAGGFDPRAYAVDAMEDHPPPDTRHGHDPR-PIPPAGQRK 23 RSP P R Y+ D+ PPP R+ D R P PP +R+ Sbjct: 760 RSPSPP---PRRRYSGDSRSPSPPPRRRYADDSRSPSPPPHRRR 800 Score = 28.1 bits (61), Expect = 9.2 Identities = 18/48 (37%), Positives = 20/48 (41%) Frame = -3 Query: 160 GCLRSPGPAGGFDPRAYAVDAMEDHPPPDTRHGHDPRPIPPAGQRKRR 17 G RSP P R YA D+ PPP R D P R+RR Sbjct: 772 GDSRSPSPP---PRRRYADDSRSPSPPPHRRRYSDDSRSPSPPPRRRR 816
>SP39_BRUSU (Q8FVX5) Probable sugar-binding periplasmic protein precursor| Length = 421 Score = 29.3 bits (64), Expect = 4.1 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 Query: 270 AIYSPVFESTSMVMKNAPPASTAVPST 350 AI SP F+S V+K + PA T VP T Sbjct: 326 AIESPAFQSAFNVVKGSAPARTDVPDT 352
>SP39_BRUME (Q8YCE2) Probable sugar-binding periplasmic protein precursor| Length = 421 Score = 29.3 bits (64), Expect = 4.1 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 Query: 270 AIYSPVFESTSMVMKNAPPASTAVPST 350 AI SP F+S V+K + PA T VP T Sbjct: 326 AIESPAFQSAFNVVKGSAPARTDVPDT 352
>SP39_BRUAB (O06875) Probable sugar-binding periplasmic protein precursor| (Immunogenic 39 kDa protein) (P39) Length = 421 Score = 29.3 bits (64), Expect = 4.1 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 Query: 270 AIYSPVFESTSMVMKNAPPASTAVPST 350 AI SP F+S V+K + PA T VP T Sbjct: 326 AIESPAFQSAFNVVKGSAPARTDVPDT 352
>YE91_HELPJ (Q9ZJC8) Putative phosphate permease jhp_1384| Length = 533 Score = 28.9 bits (63), Expect = 5.4 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +3 Query: 165 LAKELSRIEPKKLGIWLVAGCCLALLTYISFARLFAIYSPVFEST 299 + K L R+ I L GC LALL +I F R +P E++ Sbjct: 238 IVKVLKRLYAVGFEIQLACGCVLALLIFILFKRFVLKKAPQLENS 282
>SP39_RHIME (Q92KZ7) Probable sugar-binding periplasmic protein precursor| Length = 414 Score = 28.9 bits (63), Expect = 5.4 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 Query: 270 AIYSPVFESTSMVMKNAPPASTAVPST 350 AI SP F+S V+K + PA T VP T Sbjct: 319 AIESPAFQSAFNVVKGSVPARTDVPDT 345
>OPSD_SEPOF (O16005) Rhodopsin| Length = 464 Score = 28.9 bits (63), Expect = 5.4 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -3 Query: 139 PAGGFDPRAYAVDAMEDHPPPDTRHGHDPRPIPPAGQ 29 P GG+ P+ Y PPP + G+ P+ PP Q Sbjct: 395 PQGGYPPQGY--------PPPPAQGGYPPQGYPPPPQ 423
>VGLH_HHV1E (P08356) Glycoprotein H precursor| Length = 838 Score = 28.5 bits (62), Expect = 7.1 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = -3 Query: 235 ARQQPATSQIPSFLGSILLSSLASRGCLRSPGPAGGFDPRA 113 AR+ P T + L + + LA+RG LRSPG F P A Sbjct: 201 ARRHPTTELDITHLHNASTTWLATRGLLRSPGRYVYFSPSA 241
>VGLH_HHV11 (P06477) Glycoprotein H precursor| Length = 838 Score = 28.5 bits (62), Expect = 7.1 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = -3 Query: 235 ARQQPATSQIPSFLGSILLSSLASRGCLRSPGPAGGFDPRA 113 AR+ P T + L + + LA+RG LRSPG F P A Sbjct: 201 ARRHPTTELDITHLHNASTTWLATRGLLRSPGRYVYFSPSA 241
>GAG_MLVDE (P29168) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 535 Score = 28.5 bits (62), Expect = 7.1 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -3 Query: 145 PGPAGGFDPRAYAV--DAMEDHPPPDTRHGHDPRPIP 41 PGP G D Y V +A+ HPPP + P+P P Sbjct: 70 PGPHGHPDQVPYIVTWEALAYHPPPWVKPFVSPKPFP 106
>RECO_PROAC (Q6A969) DNA repair protein recO (Recombination protein O)| Length = 246 Score = 28.5 bits (62), Expect = 7.1 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 9/56 (16%) Frame = -3 Query: 196 LGSILLSSLASRG-------CLR--SPGPAGGFDPRAYAVDAMEDHPPPDTRHGHD 56 L S LL SL++ G C+R +PGP GF P V + + PP T H H+ Sbjct: 140 LDSYLLRSLSASGYAPDLVDCVRCGTPGPHQGFSPSLGGVVCI-NCQPPGTPHPHE 194
>SC24C_ARATH (Q9M291) Protein transport protein Sec24-like CEF| Length = 1097 Score = 28.1 bits (61), Expect = 9.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -3 Query: 145 PGPAGGFDPRAYAVDAMEDHPPPDTRHGHDPRPIPPAGQ 29 PG G + A + + + PP G PRP PP GQ Sbjct: 27 PGSQGNPNSLAANMQNLNINRPPPPMPGSGPRPSPPFGQ 65
>SEC20_YEAST (P28791) Protein transport protein SEC20| Length = 383 Score = 28.1 bits (61), Expect = 9.2 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 192 PKKLGIWLVAGCCLALLTYISFARLFAIYSPVFESTSMVMKNAPPASTAVPST 350 P KLG+WL+ +L + + +A S ++ S+V+ NAP +T S+ Sbjct: 299 PVKLGLWLLFKFFKGILVTLGLVKSYAGSSSSLQAPSLVL-NAPILATTTTSS 350
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 28.1 bits (61), Expect = 9.2 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -3 Query: 139 PAGGFDPRAYAVDAMEDHPPPDTRHGHDPRP 47 P+GG P P P +RHGH P P Sbjct: 151 PSGGHTPPRGQHPPSHRRPSPPSRHGHPPPP 181
>GAG_MLVDU (P23090) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 528 Score = 28.1 bits (61), Expect = 9.2 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -3 Query: 145 PGPAGGFDPRAYAV--DAMEDHPPPDTRHGHDPRPIP 41 PGP G D Y V +A+ HPPP + P+P P Sbjct: 70 PGPHGHPDQVPYIVTWEALVYHPPPWVKPFVSPKPFP 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,369,181 Number of Sequences: 219361 Number of extensions: 738711 Number of successful extensions: 3152 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 2825 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3128 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
