| Clone Name | baet37f02 |
|---|---|
| Clone Library Name | barley_pub |
>EA92_VICFA (P21747) Embryonic abundant protein USP92 precursor| Length = 268 Score = 37.7 bits (86), Expect = 0.014 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 128 ILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLL 244 +L+ +A VG A + YW+S PNTP+P + S LL Sbjct: 8 VLSLFCLAFVGITATSSEEDYWQSIWPNTPLPKTFSDLL 46
>EA30_VICFA (P21745) Embryonic abundant protein VF30.1 precursor| Length = 268 Score = 37.4 bits (85), Expect = 0.018 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 128 ILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLL 244 +L+ +A VG A + YW+S PNTP+P + S LL Sbjct: 8 VLSLFCLAFVGITATSSGEDYWQSIWPNTPLPKTFSDLL 46
>RD22_ARATH (Q08298) Dehydration-responsive protein RD22 precursor| Length = 392 Score = 37.0 bits (84), Expect = 0.023 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +2 Query: 110 RLVAAGILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLL 244 RL +L ++ ++ A P +YW +ALPNTP+P+SL LL Sbjct: 4 RLPLICLLGSFMVVAIA--ADLTPERYWSTALPNTPIPNSLHNLL 46
>SVF30_VICFA (P09059) Unknown seed protein 30.1 precursor (VF30.1)| Length = 268 Score = 35.8 bits (81), Expect = 0.052 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +2 Query: 128 ILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQL 241 +L+ +A VG A + YW+S PNTP+P + S L Sbjct: 8 VLSLFCLAFVGITATSSGEDYWQSIWPNTPLPKTFSDL 45
>EA87_VICFA (P21746) Embryonic abundant protein USP87 precursor| Length = 268 Score = 35.8 bits (81), Expect = 0.052 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 128 ILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLL 244 +L+ +A VG A YW+S PNTP+P + S +L Sbjct: 8 VLSLFCLAFVGITATSPREDYWQSIWPNTPLPKTFSDML 46
>PPSA_MYCTU (Q10977) Phenolpthiocerol synthesis polyketide synthase ppsA| Length = 1876 Score = 31.2 bits (69), Expect = 1.3 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +2 Query: 119 AAGILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLLDTQ 253 AAGI F+ H P Q++E+A P+ P +++DTQ Sbjct: 452 AAGIAGFIKTVLAVQHGQIPPNQHFETANPHIPFTDLRMKVVDTQ 496
>KLK9_HUMAN (Q9UKQ9) Kallikrein-9 precursor (EC 3.4.21.-) (Kallikrein-like| protein 3) (KLK-L3) Length = 250 Score = 30.8 bits (68), Expect = 1.7 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -2 Query: 167 HGFLPTRSVGRQECRLRRAYPWRAG 93 HG+ TR++G +ECR + PW+AG Sbjct: 16 HGWADTRAIGAEECR-PNSQPWQAG 39
>OSP4_PEA (P17771) Organ-specific protein P4| Length = 130 Score = 28.9 bits (63), Expect = 6.3 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +2 Query: 128 ILAFLLIASVGSHAARAPGQYWESALPNTPMPSSLSQLLD 247 + FL++A+V S + G+YW+ + + MP + LLD Sbjct: 13 LFLFLIVANVESR--KDVGEYWKLVMKDQDMPEEIQGLLD 50
>FBIC_NOCFA (Q5YQD7) FO synthase (EC 2.5.1.-)| (7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase) Length = 865 Score = 28.5 bits (62), Expect = 8.2 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = -3 Query: 451 AVARLDVDTHAALADADRSPAGLGAARLHVNADATLAHID 332 A RLD D AAL A+R PAGL + A A A +D Sbjct: 487 APERLDSDVLAALRAAERDPAGLSDDQYLALATADGAELD 526
>ADA15_RAT (Q9QYV0) ADAM 15 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 15) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15) (MDC-15) (Metalloprotease RGD disintegrin protein) (Metargidin) (CRII-7) Length = 816 Score = 28.5 bits (62), Expect = 8.2 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +1 Query: 127 HSCLPTDRVGRKPC-SSCSGAILGVC-SSQHSH 219 H C P D +G + C S C G GVC SS+H H Sbjct: 646 HRCQPVDLLGAQECRSKCHGH--GVCDSSRHCH 676
>AMPD2_HUMAN (Q01433) AMP deaminase 2 (EC 3.5.4.6) (AMP deaminase isoform L)| Length = 879 Score = 28.5 bits (62), Expect = 8.2 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -2 Query: 137 RQECRLRRAYPWRAGQRAAMRKLTAGPSQCEDD 39 R C L ++ P AG+R + GPS+C D Sbjct: 12 RSRCFLHQSLPLGAGRRKGLDVAEPGPSRCRSD 44 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,120,342 Number of Sequences: 219361 Number of extensions: 901368 Number of successful extensions: 2781 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2773 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)