| Clone Name | baet37b06 |
|---|---|
| Clone Library Name | barley_pub |
>TRPC_SYNY3 (Q55508) Indole-3-glycerol phosphate synthase (EC 4.1.1.48) (IGPS)| Length = 295 Score = 33.1 bits (74), Expect = 0.28 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +3 Query: 363 KAVPRNILEQIVWDKEVEVSQ 425 +A PR+ILE+IVW KE EV+Q Sbjct: 25 EAAPRHILEEIVWHKEKEVAQ 45
>TRPC_ARATH (P49572) Indole-3-glycerol phosphate synthase, chloroplast| precursor (EC 4.1.1.48) (IGPS) Length = 402 Score = 32.3 bits (72), Expect = 0.48 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +3 Query: 357 DDKAVPRNILEQIVWDKEVEVSQ 425 +D PRNILE+I W K+VEVS+ Sbjct: 121 NDADSPRNILEEITWYKDVEVSR 143
>PDE4A_RAT (P54748) cAMP-specific 3',5'-cyclic phosphodiesterase 4A (EC| 3.1.4.17) (DPDE2) Length = 844 Score = 29.6 bits (65), Expect = 3.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 149 PPQRQWGSPRRPMRRSQGGHP 211 PPQ W PR P+R Q G+P Sbjct: 29 PPQHLWRQPRTPIRIQQRGYP 49
>INP5E_RAT (Q9WVR1) 72 kDa inositol polyphosphate 5-phosphatase (EC 3.1.3.36)| (Phosphatidylinositol-4,5-bisphosphate 5-phosphatase) (Phosphatidylinositol polyphosphate 5-phosphatase type IV) (5-phosphatase that induces arborization) (Pharbin) Length = 647 Score = 28.5 bits (62), Expect = 6.9 Identities = 19/62 (30%), Positives = 25/62 (40%), Gaps = 6/62 (9%) Frame = +2 Query: 53 RGLPNGVTAGRRALPCRGLLVRVLSVRPLAVCP------PQRQWGSPRRPMRRSQGGHPV 214 RG +T A PCRG L ++ P P ++ PRRP +G HP Sbjct: 101 RGSQEDLTVQNGASPCRGSLQDSVAQSPAYSRPLPCLSTSLQEIPKPRRPQAAREGAHPC 160 Query: 215 RV 220 V Sbjct: 161 GV 162
>SORC1_MOUSE (Q9JLC4) VPS10 domain-containing receptor SorCS1 precursor (mSorCS)| Length = 1167 Score = 28.1 bits (61), Expect = 9.0 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 3/59 (5%) Frame = +2 Query: 56 GLPNGVTAGRRALPCRGLLVRVLS---VRPLAVCPPQRQWGSPRRPMRRSQGGHPVRVG 223 G +G +AG AL L+ +L+ L+ CPPQ +PRR + HP +G Sbjct: 5 GAGDGSSAGLSALLAGAGLLMLLAPGVCSSLSCCPPQHPSSTPRRTLTPRGFPHPGPLG 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,762,574 Number of Sequences: 219361 Number of extensions: 705365 Number of successful extensions: 2166 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2166 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)