| Clone Name | baet35g09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TEGU_EBV (P03186) Large tegument protein | 29 | 3.9 | 2 | FABI_PSEAE (Q9ZFE4) Enoyl-[acyl-carrier-protein] reductase [NADH... | 28 | 8.8 |
|---|
>TEGU_EBV (P03186) Large tegument protein| Length = 3149 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +1 Query: 139 SATPTGWGSRAPSRR 183 SA PTGWG+ AP+RR Sbjct: 1987 SAPPTGWGNGAPTRR 2001
>FABI_PSEAE (Q9ZFE4) Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9)| (NADH-dependent enoyl-ACP reductase) Length = 265 Score = 27.7 bits (60), Expect = 8.8 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +3 Query: 21 AADGAVTARVVLPSGELREYSPPATAALALEEVGQKGWFLCDADRMGFEGSV 176 AA G + R +L + E + P + +EEVG G FLC G G + Sbjct: 199 AASGIKSFRKMLAANERQT---PLRRNVTIEEVGNAGAFLCSDLASGISGEI 247 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.131 0.492 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,190,784 Number of Sequences: 219361 Number of extensions: 251359 Number of successful extensions: 1214 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1200 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1214 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)