| Clone Name | baet35e06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POLS_RRV2 (P17517) Structural polyprotein [Contains: E2 envelope... | 28 | 8.3 |
|---|
>POLS_RRV2 (P17517) Structural polyprotein [Contains: E2 envelope| glycoprotein] (Fragment) Length = 422 Score = 27.7 bits (60), Expect = 8.3 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 107 GNSAMVVTMLLSLCVLTFIKARYCSTPYPNKPAPLLDLEAGI 232 G S M + L + C + R C TPY P ++ L G+ Sbjct: 372 GXSLMALLTLAATCCMLATARRKCLTPYALTPGAVVPLTLGL 413 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.130 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,046,433 Number of Sequences: 219361 Number of extensions: 233315 Number of successful extensions: 741 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 741 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)