| Clone Name | baet35c03 |
|---|---|
| Clone Library Name | barley_pub |
>MAN1_MOUSE (Q9WU40) Inner nuclear membrane protein Man1 (LEM domain containing| protein 3) (Fragment) Length = 331 Score = 29.6 bits (65), Expect = 4.1 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = +1 Query: 325 PASGIVMSGHPAEVDAAPSCTSSRGPESGVSEKTSGAGAHGGMLDAD 465 PA+G V GHP E S +R P +G + AG+ G DAD Sbjct: 177 PAAGEVTGGHPGERRKPHSWWGARRP-AGPEPQPPAAGSDGAAEDAD 222
>IF2_THEFY (Q47RV1) Translation initiation factor IF-2| Length = 955 Score = 29.3 bits (64), Expect = 5.3 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -2 Query: 236 PVRPGRARPAWASSSSGSRP*DHGTGAGVAPR 141 P PG ARP+ +S S G R G G G PR Sbjct: 259 PTPPGGARPSTSSRSGGGR--GRGGGGGAGPR 288
>RFX1_MOUSE (P48377) DNA-binding protein RFX1| Length = 963 Score = 28.9 bits (63), Expect = 6.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 355 PAEVDAAPSCTSSRGPESGVSEKTSGAGAHGG 450 P V +P SS E+G S + GAG +GG Sbjct: 348 PMYVSGSPIVASSSSSEAGASNSSVGAGGNGG 379
>RP1L1_HUMAN (Q8IWN7) Retinitis pigmentosa 1-like 1 protein| Length = 2480 Score = 28.9 bits (63), Expect = 6.9 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +1 Query: 349 GHPAEVDAAPSCTSSRGPESGVSEKTS---GAGAHG 447 G P E P T S GP SG S ++S GAG+ G Sbjct: 886 GSPQEGTRQPGPTPSPGPNSGASRRSSASQGAGSRG 921
>7LESS_DROME (P13368) Protein sevenless (EC 2.7.10.1)| Length = 2554 Score = 28.5 bits (62), Expect = 9.1 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -2 Query: 410 PDSGPRLLVHDG--AASTSAGWPDMTMPD 330 PDSG +LV AAS SA WP +PD Sbjct: 779 PDSGQLILVEQQGQAASPSASWPLKNLPD 807
>MEGF8_MOUSE (P60882) Multiple epidermal growth factor-like domains 8 (EGF-like| domain-containing protein 4) (Multiple EGF-like domain protein 4) Length = 2330 Score = 28.5 bits (62), Expect = 9.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 160 PVPWSYGRLPDDDEAQAGRAR 222 P W+Y R PD DE + G AR Sbjct: 605 PARWAYARCPDVDECRLGLAR 625
>MEGF8_HUMAN (Q7Z7M0) Multiple epidermal growth factor-like domains 8 (EGF-like| domain-containing protein 4) (Multiple EGF-like domain protein 4) Length = 2386 Score = 28.5 bits (62), Expect = 9.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 160 PVPWSYGRLPDDDEAQAGRAR 222 P W+Y R PD DE + G AR Sbjct: 605 PARWAYARCPDVDECRLGLAR 625
>SARM1_MOUSE (Q6PDS3) Sterile alpha and TIR motif-containing protein 1 (Tir-1| homolog) Length = 724 Score = 28.5 bits (62), Expect = 9.1 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 239 GPVRPGRARPAWASSSSGSRP*DHGTGAGV 150 GP R G A P WA+ GSR G G V Sbjct: 32 GPDRSGGASPWWAAGGRGSREVSPGVGTEV 61 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,361,829 Number of Sequences: 219361 Number of extensions: 642383 Number of successful extensions: 2506 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2505 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)