| Clone Name | baet35a08 |
|---|---|
| Clone Library Name | barley_pub |
>NLTP2_TOBAC (Q03461) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 114 Score = 34.3 bits (77), Expect = 0.074 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +2 Query: 236 ADKAECVDKLMGLATCLTYVQVSATARAPTPDCCSGFRQVLGVSK 370 A+ C GLA CL Y+Q R P CC G + +LG +K Sbjct: 22 AEALSCGQVQSGLAPCLPYLQ----GRGPLGSCCGGVKGLLGAAK 62
>NLTP1_LYCES (P93224) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 114 Score = 34.3 bits (77), Expect = 0.074 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 236 ADKAECVDKLMGLATCLTYVQVSATARAPTPDCCSGFRQVLGVSK 370 A+ C + GLA CL Y++ R P CC G + +LG +K Sbjct: 22 AESLSCGEVTSGLAPCLPYLE----GRGPLGGCCGGVKGLLGAAK 62
>NLTP2_LYCES (P27056) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 114 Score = 33.9 bits (76), Expect = 0.096 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +2 Query: 236 ADKAECVDKLMGLATCLTYVQVSATARAPTPDCCSGFRQVLGVSK 370 A+ C GLA CL Y+Q R P CC G + +LG +K Sbjct: 22 AEALTCGQVTAGLAPCLPYLQ----GRGPLGGCCGGVKNLLGSAK 62
>ZM33_MAIZE (O82106) Anther-specific protein MZm3-3 precursor| Length = 109 Score = 32.3 bits (72), Expect = 0.28 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +2 Query: 251 CVDKLMGLATCLTYVQVSATAR---APTPDCCSGFRQVLGVSKKCLC 382 C +L GLA CL Y + AP P+CCS VS+ C C Sbjct: 45 CAGQLRGLAPCLRYSVPPLPGQVPPAPGPECCSALG---AVSRDCAC 88
>CWC22_NEUCR (Q7RX84) Pre-mRNA-splicing factor cwc-22| Length = 1010 Score = 31.6 bits (70), Expect = 0.48 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -2 Query: 362 RPAPAGTRSSSRAWVRAPSPTPAR 291 R +GTRS SR++ R+PSP PAR Sbjct: 834 RRGRSGTRSRSRSYSRSPSPPPAR 857
>MC1_PINRA (O24493) Male-cone protein 1 precursor (PRMC1)| Length = 92 Score = 31.2 bits (69), Expect = 0.63 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +2 Query: 233 AADKAECVDKLMGLATCLTYVQVSATARAPTPDCCSGFRQVLGVSKKCLC 382 A +C + + LA C + V +S+ P+ +CC + G S C+C Sbjct: 22 AVQAEDCSNAMDKLAPCTSAVGLSSNGVKPSSECCDALK---GTSTSCVC 68
>A9_BRANA (Q05772) Tapetum-specific protein A9 precursor| Length = 96 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +2 Query: 248 ECVDKLMGLATCLTYVQVSATARAPTPDCCSGFRQVLGVSKKCLC 382 +C+D L + C V A AP +CC + +K C+C Sbjct: 31 QCLDNLSNMQVCAPLVLPGAVNPAPNSNCCIALQ---ATNKDCIC 72
>SFR16_HUMAN (Q8N2M8) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) Length = 659 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = -2 Query: 389 RARTGTSC*RPAPAGTRSSSRAWVRAPSPTPAR 291 R+ T + P+P+ +RS SR+ ++PSP+PAR Sbjct: 491 RSLTRSRSHSPSPSQSRSRSRSRSQSPSPSPAR 523
>UGPI5_ARATH (Q9C7F7) Uncharacterized GPI-anchored protein At1g27950 precursor| Length = 193 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/48 (27%), Positives = 19/48 (39%) Frame = +2 Query: 248 ECVDKLMGLATCLTYVQVSATARAPTPDCCSGFRQVLGVSKKCLCVLV 391 EC + CL + AT P+ CC + KCLC ++ Sbjct: 34 ECNQDFQKVTLCLDFATGKATI--PSKKCCDAVEDIKERDPKCLCFVI 79
>NLTP_PYRCO (Q9M5X6) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Pyr c 3) Length = 115 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 251 CVDKLMGLATCLTYVQVSATARAPTPDCCSGFRQVLGVSK 370 C LA C+ YV+ + A P CC+G + + G++K Sbjct: 27 CSQVSANLAPCINYVR---SGGAVPPACCNGIKTINGLAK 63
>WRK19_ARATH (Q9SZ67) Probable WRKY transcription factor 19 (WRKY DNA-binding| protein 19) Length = 1895 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 46 LESSSASHAREGNTSQLWQCGRGLSIGKLPS*HHGVSA 159 + ++S +A EG+ WQ G+ L G L S + G+SA Sbjct: 1609 ISNTSPIYASEGSFITCWQKGQLLGRGSLGSVYEGISA 1646
>NLTP_MALDO (Q9M5X7) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Mal d 3) Length = 115 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 251 CVDKLMGLATCLTYVQVSATARAPTPDCCSGFRQVLGVSK 370 C LA C+ YV+ + A P CC+G R + G+++ Sbjct: 27 CGQVTSSLAPCIGYVR---SGGAVPPACCNGIRTINGLAR 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,276,787 Number of Sequences: 219361 Number of extensions: 503889 Number of successful extensions: 1487 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1478 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)