| Clone Name | baet34e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LRP1_HHV1F (P17588) Latency-related protein 1 | 29 | 5.0 | 2 | GPHA2_RAT (Q925Q4) Glycoprotein hormone alpha 2 precursor (Thyro... | 28 | 6.6 | 3 | LRP2_HHV1F (P17589) Latency-related protein 2 | 28 | 8.6 | 4 | SCN5A_RAT (P15389) Sodium channel protein type 5 alpha subunit (... | 28 | 8.6 |
|---|
>LRP1_HHV1F (P17588) Latency-related protein 1| Length = 340 Score = 28.9 bits (63), Expect = 5.0 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = +3 Query: 30 RRPTPGCHAHPHVRLPPAGRRGRCHRPHSR----PRT 128 R PTP +HPH R PP R PHS PRT Sbjct: 41 RTPTP---SHPHSRAPPLPRAPTPTHPHSHAPPLPRT 74
>GPHA2_RAT (Q925Q4) Glycoprotein hormone alpha 2 precursor (Thyrostimulin| alpha subunit) Length = 130 Score = 28.5 bits (62), Expect = 6.6 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 36 PTPGCHAHPHVRLPPAGRRGRCHRPH 113 P PGCH HP + R G C H Sbjct: 28 PIPGCHLHPFNVTVRSDRHGTCQGSH 53
>LRP2_HHV1F (P17589) Latency-related protein 2| Length = 107 Score = 28.1 bits (61), Expect = 8.6 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +3 Query: 30 RRPTPGCHAHPHVRLPPAGRRGRCHRPHSR--PRTL 131 R PTP AHPH PP R PHS PR++ Sbjct: 23 RTPTP---AHPHSHAPPLPRTPTPTHPHSHAPPRSI 55
>SCN5A_RAT (P15389) Sodium channel protein type 5 alpha subunit (Sodium channel| protein type V alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.5) (Sodium channel protein, cardiac muscle alpha-subunit) Length = 2019 Score = 28.1 bits (61), Expect = 8.6 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -1 Query: 313 WSSGSEKSSS---AMRSHGDWLRSQQGSPQEEASGTTRSPLDS 194 WS SE +SS A S DW + Q+ PQ A G +P DS Sbjct: 1097 WSQVSETTSSEAGASTSQADWQQEQKTEPQ--APGCGETPEDS 1137 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,107,108 Number of Sequences: 219361 Number of extensions: 713860 Number of successful extensions: 3162 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3150 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)