| Clone Name | baet33a11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PORA_HORVU (P13653) Protochlorophyllide reductase A, chloroplast... | 57 | 1e-08 | 2 | PORA_WHEAT (Q41578) Protochlorophyllide reductase A, chloroplast... | 55 | 4e-08 | 3 | RPOA_ANAMM (Q5PA81) DNA-directed RNA polymerase alpha chain (EC ... | 32 | 0.45 | 4 | ALGE_PSEAE (P18895) Alginate production protein algE precursor | 28 | 6.5 |
|---|
>PORA_HORVU (P13653) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 388 Score = 57.0 bits (136), Expect = 1e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 130 TLSVPKKGSSMGAVAVKDTAAFLGVSSKA 216 TLSVPKKGSSMGAVAVKDTAAFLGVSSKA Sbjct: 9 TLSVPKKGSSMGAVAVKDTAAFLGVSSKA 37
>PORA_WHEAT (Q41578) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 388 Score = 55.5 bits (132), Expect = 4e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +1 Query: 130 TLSVPKKGSSMGAVAVKDTAAFLGVSSKA 216 TLSVPKKGSSMGA AVKDTAAFLGVSSKA Sbjct: 9 TLSVPKKGSSMGAAAVKDTAAFLGVSSKA 37
>RPOA_ANAMM (Q5PA81) DNA-directed RNA polymerase alpha chain (EC 2.7.7.6) (RNAP| alpha subunit) (Transcriptase alpha chain) (RNA polymerase alpha subunit) Length = 366 Score = 32.0 bits (71), Expect = 0.45 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = -2 Query: 188 AVSFTATAPMLLPFLGTERVEGRSWRAMDDGELGLSLASTALQEFNELEL 39 AVS L F+G+E VEG S + +D E L L++ +ELEL Sbjct: 243 AVSARVLQDQLQSFIGSEEVEGESRKKVDKEEGALPYDHNLLRKVDELEL 292
>ALGE_PSEAE (P18895) Alginate production protein algE precursor| Length = 490 Score = 28.1 bits (61), Expect = 6.5 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = -2 Query: 116 WRAMDDGELGLSLASTALQEFNE---LELECTVMLYFTSGL 3 WR DD ++G S + ALQ + EL+ V YF GL Sbjct: 402 WRVDDDSDIGTSGINAALQPGEKDIGQELDLVVTKYFKQGL 442 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.310 0.123 0.323 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,573,989 Number of Sequences: 219361 Number of extensions: 211705 Number of successful extensions: 526 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 526 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)