| Clone Name | baet32a07 |
|---|---|
| Clone Library Name | barley_pub |
>HTPG_NITWN (Q3SNS6) Chaperone protein htpG (Heat shock protein htpG) (High| temperature protein G) Length = 637 Score = 32.3 bits (72), Expect = 0.27 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = -2 Query: 192 YLRFTDCRKSGSRRRTRTEKVGDPASGTDGSTPRFTISVDSSSRAMA 52 +LR + + R R E + DPA TD + PR +I++D+ R +A Sbjct: 38 FLRELISNAADACERLRYEAISDPALLTDETRPRISITIDAERRQLA 84
>CBK1_CANGA (Q6FP74) Serine/threonine-protein kinase CBK1 (EC 2.7.11.1)| Length = 773 Score = 32.0 bits (71), Expect = 0.36 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -2 Query: 141 TEKVGDPASGTDGSTPRFTISVDSSSRAMAGRSWVAAWR 25 T K G P DGS R T+ VDS + M+ R + WR Sbjct: 537 TTKNGAPNDAGDGSNNRQTMIVDSINLTMSNRQQIQTWR 575
>LOX21_HORVU (P93184) Lipoxygenase 2.1, chloroplast precursor (EC 1.13.11.12)| (LOX-100) (LOX2:Hv:1) Length = 936 Score = 29.6 bits (65), Expect = 1.8 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = -2 Query: 198 RTYLRFTDCRKSGSRRRTRTEKVGDPASGTDGSTPRFTISVDSSSRAM 55 RT++ RK G+ RRT KVG ++ T +T T+S DS+ A+ Sbjct: 23 RTFVVPEARRKPGNGRRTSVSKVGSTSTSTT-TTTTTTLSADSNGAAV 69
>SCG2_HUMAN (P13521) Secretogranin-2 precursor (Secretogranin II) (SgII)| (Chromogranin C) [Contains: Secretoneurin (SN)] Length = 617 Score = 29.3 bits (64), Expect = 2.3 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +2 Query: 227 GVYLATIPVIVLVCGAEVGSLSRDELWRK 313 G L+ IP+I L+ GAE S R++L +K Sbjct: 10 GAALSLIPLIFLISGAEAASFQRNQLLQK 38
>PRMA_CHLTE (Q8KG70) Ribosomal protein L11 methyltransferase (EC 2.1.1.-) (L11| Mtase) Length = 289 Score = 29.3 bits (64), Expect = 2.3 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = -2 Query: 111 TDGSTPRFTISVDSSSRAMAGRSWVAAWRARL 16 T GS PRFT S MA R+W A W A L Sbjct: 67 TFGSVPRFTASF------MADRNWNAEWEAHL 92
>PGRC2_HUMAN (O15173) Membrane-associated progesterone receptor component 2| (Progesterone membrane-binding protein) (Steroid receptor protein DG6) Length = 223 Score = 29.3 bits (64), Expect = 2.3 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -2 Query: 135 KVGDPASGTDGSTPRFTISVDSSSRAMAGRSWVAAWRARLVGGGD 1 K+G SG++ S + S + A G W AA A L GGG+ Sbjct: 9 KLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTGGGE 53
>RECX_PASMU (Q9CK20) Regulatory protein recX| Length = 164 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/53 (24%), Positives = 29/53 (54%) Frame = +2 Query: 71 LSTEIVNRGVEPSVPDAGSPTFSVRVRRRLPDFLQSVNLKYVRLGYHYLLSHG 229 +S+ +++ + PD +V +R++ P + + +LK + + Y+LSHG Sbjct: 96 ISSALISEAEQTLAPDWQHHALTV-LRKKFPQYAEITDLKLKQKVWRYMLSHG 147
>CHBG_SERMA (Q8L3B9) UPF0249 protein chbG| Length = 253 Score = 28.1 bits (61), Expect = 5.2 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 9/44 (20%) Frame = +2 Query: 200 LGYHYLLSHGVYLATIPVIVLVCG---------AEVGSLSRDEL 304 +G H++L+HG L +P +V G AE G LS DE+ Sbjct: 58 IGLHFVLTHGKPLGAMPSLVNEHGELGKWLWRRAEAGELSLDEI 101
>GLGA_HAEI8 (Q4QK70) Glycogen synthase (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase) Length = 476 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +2 Query: 68 ELSTEIVNRGVEPSVPDAGSPTFSVRVRRRLPDFLQSVNLKYVRLGYHYLLSH 226 E + EIV +G + + +G+P F +R + Q++ V++GY LSH Sbjct: 312 ESADEIVKQGGQLMILGSGAPHFEQGIRELAERYPQNI---AVKIGYDEALSH 361
>MVIN_TREPA (O83529) Virulence factor mviN homolog| Length = 526 Score = 27.7 bits (60), Expect = 6.8 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +2 Query: 158 LPDFLQSVNLKYVRLGYHYLLSHGVYLATIPVIVLVCGAEVGSLSRDE 301 +P + S Y G H ++SHGV L +I G + LSRDE Sbjct: 466 VPTWASSFFTAYFFPGSHKIISHGVPLCVEALIFSCTGCILLLLSRDE 513
>RPGRH_CAEEL (Q5DX34) X-linked retinitis pigmentosa GTPase regulator homolog| Length = 1392 Score = 27.3 bits (59), Expect = 8.8 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -2 Query: 204 PSRTYLRFTDCRKSGSRRRTRTEKVGDPASGTDGSTPRFTISV 76 P +R +K S + TE P+ T+GSTPR +++ Sbjct: 960 PQELKMRMFVMKKIRSAQLKNTEDPSSPSPSTNGSTPRVNLNL 1002
>DNAJ2_CORDI (Q6NEZ1) Chaperone protein dnaJ 2| Length = 390 Score = 27.3 bits (59), Expect = 8.8 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 177 DCRKSGSRRRTRTEKVGDPASGTDGSTPR 91 DC +G++RRTR+ V PA DG R Sbjct: 228 DCSGTGTQRRTRSITVRIPAGVVDGQKVR 256
>ARLY2_RHILO (Q981V0) Argininosuccinate lyase 2 (EC 4.3.2.1) (Arginosuccinase 2)| (ASAL 2) Length = 927 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 8 PPTSLARQAATQLRPAMAREELSTEIVNRGVEPSVPDAG 124 PP AR A + R A +L + +R +P+VP+AG Sbjct: 339 PPRGSARAGAIRFRLAPTSGKLKSLGFSRNPDPTVPEAG 377
>CBK1_YEAST (P53894) Serine/threonine-protein kinase CBK1 (EC 2.7.11.1) (Cell| wall biosynthesis kinase) Length = 756 Score = 27.3 bits (59), Expect = 8.8 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -2 Query: 120 ASGTDGSTPRFTISVDSSSRAMAGRSWVAAWR 25 A+ TD + R T+ VDS S M+ R + WR Sbjct: 530 ANTTDTANKRQTMVVDSISLTMSNRQQIQTWR 561
>PER44_ARATH (Q93V93) Peroxidase 44 precursor (EC 1.11.1.7) (Atperox P44)| (ATP35) Length = 310 Score = 27.3 bits (59), Expect = 8.8 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 29 QAATQLRPAMAREELSTEIVNRGVEPSVPDAGSPTFSVRVRRR 157 +A QL A R +IV SV AG P FSV RR Sbjct: 101 EAKRQLEAACPRTVSCADIVTLATRDSVALAGGPRFSVPTGRR 143
>TLN1_HUMAN (Q9Y490) Talin-1| Length = 2541 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = -2 Query: 129 GDPASGTDGSTPRFTISVDSSSRAMAGRSWVAAWRARLVGGGD 1 G + +G+ P F ++ ++S+A+ G + AA A LVG D Sbjct: 1409 GISQNAKNGNLPEFGDAISTASKALCGFTEAAAQAAYLVGVSD 1451
>RUVB_EHRRW (Q5HAK4) Holliday junction ATP-dependent DNA helicase ruvB (EC| 3.6.1.-) Length = 331 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +2 Query: 59 AREELSTEIVNRGVEP-SVPDAGSPTFSVRVRRRLPDFL 172 A + + T I N G E S+ G+P ++R+ RR+ DF+ Sbjct: 194 AAKVIHTNISNNGAEEISLRSRGTPRIALRLLRRIRDFI 232
>RUVB_EHRRG (Q5FG39) Holliday junction ATP-dependent DNA helicase ruvB (EC| 3.6.1.-) Length = 331 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +2 Query: 59 AREELSTEIVNRGVEP-SVPDAGSPTFSVRVRRRLPDFL 172 A + + T I N G E S+ G+P ++R+ RR+ DF+ Sbjct: 194 AAKVIHTNISNNGAEEISLRSRGTPRIALRLLRRIRDFI 232
>CUT1_CAEEL (Q03755) Cuticlin-1 precursor| Length = 424 Score = 27.3 bits (59), Expect = 8.8 Identities = 18/61 (29%), Positives = 27/61 (44%) Frame = +2 Query: 62 REELSTEIVNRGVEPSVPDAGSPTFSVRVRRRLPDFLQSVNLKYVRLGYHYLLSHGVYLA 241 R E++T + G PS P+A + VRRR S + +G+ L G +A Sbjct: 351 RVEINTLDIMEGASPSAPEAAALVSEESVRRR----ATSTGICLTPIGFASFLGIGTIVA 406 Query: 242 T 244 T Sbjct: 407 T 407 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.137 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,997,231 Number of Sequences: 219361 Number of extensions: 509098 Number of successful extensions: 1503 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1502 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)