| Clone Name | baet31g10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TER_EUGGR (Q5EU90) Trans-2-enoyl-CoA reductase, mitochondrial pr... | 29 | 5.1 | 2 | DHPS_SHIFL (P0AC15) Dihydropteroate synthase (EC 2.5.1.15) (DHPS... | 29 | 5.1 | 3 | DHPS_ECOLI (P0AC13) Dihydropteroate synthase (EC 2.5.1.15) (DHPS... | 29 | 5.1 | 4 | DHPS_ECOL6 (P0AC14) Dihydropteroate synthase (EC 2.5.1.15) (DHPS... | 29 | 5.1 |
|---|
>TER_EUGGR (Q5EU90) Trans-2-enoyl-CoA reductase, mitochondrial precursor (EC| 1.3.1.44) Length = 539 Score = 28.9 bits (63), Expect = 5.1 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 118 VRPAMATIVNTTEEEPMLAVVRS-IAQQTWADAGPEVADPEVA 243 +RP A + T E P +A S A WA AGP+ A P VA Sbjct: 55 MRPTTAAALTTMREVPQMAEGFSGEATSAWAAAGPQWAAPLVA 97
>DHPS_SHIFL (P0AC15) Dihydropteroate synthase (EC 2.5.1.15) (DHPS)| (Dihydropteroate pyrophosphorylase) Length = 282 Score = 28.9 bits (63), Expect = 5.1 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +1 Query: 112 EGVRPAMATIVNTTEEEPMLAVVRSIAQQTWADAGPEVADPEVARLCAEAQQHVL 276 E RP A + E + ++ VV +IAQ+ + + PEV R A+ H++ Sbjct: 60 ESTRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHII 114
>DHPS_ECOLI (P0AC13) Dihydropteroate synthase (EC 2.5.1.15) (DHPS)| (Dihydropteroate pyrophosphorylase) Length = 282 Score = 28.9 bits (63), Expect = 5.1 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +1 Query: 112 EGVRPAMATIVNTTEEEPMLAVVRSIAQQTWADAGPEVADPEVARLCAEAQQHVL 276 E RP A + E + ++ VV +IAQ+ + + PEV R A+ H++ Sbjct: 60 ESTRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHII 114
>DHPS_ECOL6 (P0AC14) Dihydropteroate synthase (EC 2.5.1.15) (DHPS)| (Dihydropteroate pyrophosphorylase) Length = 282 Score = 28.9 bits (63), Expect = 5.1 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +1 Query: 112 EGVRPAMATIVNTTEEEPMLAVVRSIAQQTWADAGPEVADPEVARLCAEAQQHVL 276 E RP A + E + ++ VV +IAQ+ + + PEV R A+ H++ Sbjct: 60 ESTRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHII 114 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,031,652 Number of Sequences: 219361 Number of extensions: 350070 Number of successful extensions: 1320 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1320 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)