| Clone Name | baet30d11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ROM1_YEAST (P53046) RHO1 GDP-GTP exchange protein 1 (Protein kin... | 31 | 1.8 | 2 | KI18A_MOUSE (Q91WD7) Kinesin family member 18A | 30 | 3.1 | 3 | GAG_IPMA (P11365) Retrovirus-related Gag polyprotein [Contains: ... | 30 | 4.0 | 4 | COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component... | 29 | 6.8 |
|---|
>ROM1_YEAST (P53046) RHO1 GDP-GTP exchange protein 1 (Protein kinase C| suppressor SKC1) Length = 1155 Score = 30.8 bits (68), Expect = 1.8 Identities = 29/115 (25%), Positives = 46/115 (40%), Gaps = 13/115 (11%) Frame = -1 Query: 363 KSSGISLA-PVRAPTYPTPLKSFHKVGLESS--------STGSSFPADSAKPVPLAVVSL 211 K+SG + P + T PTP + H + L SS ST S F +S K + Sbjct: 163 KNSGSHMGDPNQLSTPPTPKSAGHTMELHSSFNGKHSSSSTSSLFALESLKTQNRRSSNS 222 Query: 210 DSRQGQWESR*STHARH*LDDE----AFGYLKRVIVTPAVYPRLVEFLHFDIQST 58 + Q+ + H RH + + + + TP VYP L+ + + T Sbjct: 223 SNHSSQYRRHTNQHQRHHSRSKSSPVSLTEISMIKGTPLVYPALLSLIAIKFKQT 277
>KI18A_MOUSE (Q91WD7) Kinesin family member 18A| Length = 886 Score = 30.0 bits (66), Expect = 3.1 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = -1 Query: 303 SFHKVGLESSSTGSSFPADSAKPVPLAVVSLDSRQGQWESR*STHARH*LDDEAFGYLKR 124 S H++ S ST S P + P +A+ + R+ W+ ST DE+ G+ KR Sbjct: 784 SVHRIESSSFSTKDSMPESAGVPSYMAMTTAAKRK--WKQMSSTSNASIKSDESCGFAKR 841 Query: 123 V 121 + Sbjct: 842 I 842
>GAG_IPMA (P11365) Retrovirus-related Gag polyprotein [Contains: Protease (EC| 3.4.23.-)] Length = 827 Score = 29.6 bits (65), Expect = 4.0 Identities = 23/72 (31%), Positives = 35/72 (48%) Frame = -1 Query: 441 PDKTGPWSQKEGTCXASDPRNK*NNVKSSGISLAPVRAPTYPTPLKSFHKVGLESSSTGS 262 PD + K G+ S PR++ +K G L+ R + P K+ HKV L ++S Sbjct: 513 PDSQSAYVPKNGS---SGPRSQ--GLKDMGTGLSGPRKQSERRPRKT-HKVDLRAASDFL 566 Query: 261 SFPADSAKPVPL 226 P S +PVP+ Sbjct: 567 LMPQMSIQPVPV 578
>COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component 1 (Low| density lipoprotein receptor defect B-complementing protein) Length = 980 Score = 28.9 bits (63), Expect = 6.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 196 SLSTIQRNHSQGNGLGGISGERRPC 270 +L T+ R H G G+G + GE + C Sbjct: 293 TLETVTRQHPTGKGIGALQGEMKLC 317 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,062,183 Number of Sequences: 219361 Number of extensions: 1353995 Number of successful extensions: 3228 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3227 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)