| Clone Name | baet29g03 |
|---|---|
| Clone Library Name | barley_pub |
>RAD9A_HUMAN (Q99638) Cell cycle checkpoint control protein RAD9A (EC 3.1.11.2)| (DNA repair exonuclease rad9 homolog A) (hRAD9) Length = 391 Score = 30.0 bits (66), Expect = 1.6 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 5/53 (9%) Frame = -1 Query: 273 PDRPDKTGPWSQKE-----RTCPASDPRNK*NNVKSSGISLAPVRAPTYPTPL 130 P P GP S++E T P + P K ++ I LAPVR+P P+P+ Sbjct: 331 PQPPKSPGPHSEEEDEAEPSTVPGTPPPKKFRSLFFGSI-LAPVRSPQGPSPV 382
>VRP1_YEAST (P37370) Verprolin| Length = 817 Score = 29.6 bits (65), Expect = 2.1 Identities = 21/66 (31%), Positives = 29/66 (43%) Frame = -1 Query: 222 PASDPRNK*NNVKSSGISLAPVRAPTYPTPLKSFHKVGLESSSTGSSFPADSAKPVPLAV 43 P+ P ++ + KSS ISL V AP P+ S T S P + P P Sbjct: 197 PSVRPAHRSHQRKSSNISLPSVSAPPLPS----------ASLPTHVSNPPQAPPPPPTPT 246 Query: 42 VSLDSR 25 + LDS+ Sbjct: 247 IGLDSK 252
>COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component 1 (Low| density lipoprotein receptor defect B-complementing protein) Length = 980 Score = 28.9 bits (63), Expect = 3.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 19 SLSTIQRNHSQGNGLGGISGERRPC 93 +L T+ R H G G+G + GE + C Sbjct: 293 TLETVTRQHPTGKGIGALQGEMKLC 317
>SYD_THEAC (Q9HJM1) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA| ligase) (AspRS) Length = 428 Score = 28.1 bits (61), Expect = 6.1 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -1 Query: 129 KSFHKVGLESSSTGSSFPADSAKPVPLAVVSLDSRQGQWESR 4 KS K G+E S T S ++ P+PL VV D Q E+R Sbjct: 77 KSISKAGIEISGTSISIVNEAEAPLPLPVV--DPVQADLETR 116
>HIS1_THET8 (Q5SM15) ATP phosphoribosyltransferase (EC 2.4.2.17) (ATP-PRTase)| (ATP-PRT) Length = 206 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +1 Query: 211 VGSGACPLLLAPRPGFIGPIR 273 +G GAC L L RPG GPIR Sbjct: 89 LGFGACRLSLIRRPGDTGPIR 109
>HIS1_THET2 (P62381) ATP phosphoribosyltransferase (EC 2.4.2.17) (ATP-PRTase)| (ATP-PRT) Length = 206 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +1 Query: 211 VGSGACPLLLAPRPGFIGPIR 273 +G GAC L L RPG GPIR Sbjct: 89 LGFGACRLSLIRRPGDTGPIR 109
>HBA1_PLEWA (P06639) Hemoglobin alpha-1 subunit (Hemoglobin alpha-1 chain)| (Alpha-1-globin) (Hemoglobin alpha-major chain) Length = 141 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 9 IPTVPVYYPAKPQPRERAWRNQRGKKTLLSLT 104 +PT +Y+PAK ++ + GKK + +LT Sbjct: 36 MPTTRIYFPAKDLSERSSYLHSHGKKVVGALT 67
>DNAJH_SYNY3 (P50027) DnAJ-like protein slr0093| Length = 332 Score = 24.6 bits (52), Expect(2) = 8.0 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 122 NDLRGVG*VGALTGASEIPLLLTLFYLFRGSE 217 ND G G A G E L LTL FRG E Sbjct: 141 NDFGGFGNAQAPAGDREATLQLTLAEAFRGVE 172 Score = 21.6 bits (44), Expect(2) = 8.0 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 Query: 213 RKRGMSSPFGSKARFY 260 R +GM+SP+G + Y Sbjct: 199 RGKGMASPYGQRGDLY 214 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,543,614 Number of Sequences: 219361 Number of extensions: 788223 Number of successful extensions: 2234 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2233 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)