| Clone Name | baet29e08 |
|---|---|
| Clone Library Name | barley_pub |
>RFNG_CHICK (O12972) Beta-1,3-N-acetylglucosaminyltransferase radical fringe| (EC 2.4.1.222) (O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase) Length = 372 Score = 31.6 bits (70), Expect = 0.47 Identities = 22/56 (39%), Positives = 27/56 (48%) Frame = -3 Query: 395 LPLPRSELPWAPVARRPPMVSPYQ*GECGSASPGGHELLLGAGERGVGRAADGAVR 228 L LPR + P AP RRPP P + A P G ++ G+RG G A G R Sbjct: 25 LLLPRGQPPAAP-RRRPPPAGPSRPSPKREARPAGSDV---PGDRGGGSGAAGGGR 76
>SMYD4_HUMAN (Q8IYR2) SET and MYND domain-containing protein 4| Length = 804 Score = 28.9 bits (63), Expect = 3.1 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -1 Query: 394 CPCPAASCRGHPLRGGPRW 338 C CPA H + GPRW Sbjct: 597 CACPACQTEAHRMAAGPRW 615
>DOF43_ARATH (Q9SUB0) Hypothetical Dof zinc finger protein DOF4.3 (AtDOF4.3)| Length = 232 Score = 28.5 bits (62), Expect = 4.0 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +3 Query: 147 VSSPPPEPVECARGTSDCT---VTNVYGSFPDRTICR 248 V PPP P CAR SD T N Y F R C+ Sbjct: 17 VKPPPPPPRVCARCDSDNTKFCYYNNYSEFQPRYFCK 53
>CAC1B_RAT (Q02294) Voltage-dependent N-type calcium channel alpha-1B subunit| (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2336 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 199 QSDVPRAHSTGSGGGLDTARPRKSTRRE 116 ++D P+A ST +G + ARPR+S +E Sbjct: 873 RTDCPKAESTETGAREERARPRRSHSKE 900
>COX11_YEAST (P19516) Cytochrome c oxidase assembly protein COX11, mitochondrial| precursor Length = 300 Score = 27.7 bits (60), Expect = 6.8 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +3 Query: 81 RAMTERSRAFTFS-LLVLFLGLAVSSPPPEPVECAR 185 R +R+ AF FS + VLFLGLA ++ P CAR Sbjct: 78 RKFKDRTVAFYFSSVAVLFLGLAYAAVPLYRAICAR 113
>CDKL5_HUMAN (O76039) Cyclin-dependent kinase-like 5 (EC 2.7.11.22)| (Serine/threonine-protein kinase 9) Length = 1030 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 147 VSSPPPEPVECARGTSDCTVTNVYGS 224 +SSP P PV RGTS C V G+ Sbjct: 958 ISSPAPYPVLQVRGTSMCPTLQVRGT 983
>DOF45_ARATH (O49550) Hypothetical Dof zinc finger protein DOF4.5 (AtDOF4.5)| Length = 249 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +3 Query: 147 VSSPPPEPVECARGTSDCT---VTNVYGSFPDRTICR 248 V PPP P CAR SD T N Y F R C+ Sbjct: 17 VKPPPPPPRVCARCDSDNTKFCYYNNYCEFQPRYFCK 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,997,951 Number of Sequences: 219361 Number of extensions: 744903 Number of successful extensions: 2722 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2720 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)