| Clone Name | baet29c12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HIS7_CAMJE (Q9PM76) Histidine biosynthesis bifunctional protein ... | 31 | 1.4 | 2 | HRCA_MYCTU (P64398) Heat-inducible transcription repressor hrcA | 29 | 5.2 | 3 | HRCA_MYCBO (P64399) Heat-inducible transcription repressor hrcA | 29 | 5.2 | 4 | PISD_CRIGR (P27465) Phosphatidylserine decarboxylase proenzyme (... | 29 | 5.2 |
|---|
>HIS7_CAMJE (Q9PM76) Histidine biosynthesis bifunctional protein hisB| [Includes: Histidinol-phosphatase (EC 3.1.3.15); Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) (IGPD)] Length = 352 Score = 30.8 bits (68), Expect = 1.4 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -1 Query: 407 EETQVAGLAADVGAC--PGFGDALGVARYGLLEPLD 306 E V +A +GAC GD +G+ARYG P+D Sbjct: 225 EHHSVEDVALALGACIKKALGDKIGIARYGFALPMD 260
>HRCA_MYCTU (P64398) Heat-inducible transcription repressor hrcA| Length = 343 Score = 28.9 bits (63), Expect = 5.2 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = -1 Query: 410 AEETQVAGLAADVGACPGFGDALGVARYGLLEPL 309 A VA LA+ +G G GDA+G A LLE L Sbjct: 193 AASVAVADLASQLGGAGGLGDAVGRAATVLLESL 226
>HRCA_MYCBO (P64399) Heat-inducible transcription repressor hrcA| Length = 343 Score = 28.9 bits (63), Expect = 5.2 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = -1 Query: 410 AEETQVAGLAADVGACPGFGDALGVARYGLLEPL 309 A VA LA+ +G G GDA+G A LLE L Sbjct: 193 AASVAVADLASQLGGAGGLGDAVGRAATVLLESL 226
>PISD_CRIGR (P27465) Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65)| [Contains: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] Length = 409 Score = 28.9 bits (63), Expect = 5.2 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -2 Query: 391 QVLLQMSVPVQVLVTPWGSHVMVFLNLWITR--YALYSRSFSKSLAFGPDDD 242 +V L SVP ++L WG V L W+ R Y+LY +F ++ +D Sbjct: 107 EVALYKSVPTRLLSRAWGRLNQVELPYWLRRPVYSLYIWTFGVNMTEAAVED 158 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.118 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,640,641 Number of Sequences: 219361 Number of extensions: 590540 Number of successful extensions: 2186 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2186 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)