| Clone Name | baet29a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATM_ASPOR (Q2U639) Serine/threonine-protein kinase tel1 (EC 2.7.... | 30 | 3.8 |
|---|
>ATM_ASPOR (Q2U639) Serine/threonine-protein kinase tel1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase tel1) (Telomere length regulation protein 1) (ATM homolog) Length = 2925 Score = 29.6 bits (65), Expect = 3.8 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +3 Query: 318 LNGPGLIGSGKLAFGATTTSKADRYNNVSLPDA 416 LNGP + L ATTT R N SLP+A Sbjct: 559 LNGPSTMSDASLTLWATTTRMTARVNPGSLPNA 591 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,550,148 Number of Sequences: 219361 Number of extensions: 531915 Number of successful extensions: 1574 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1570 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)