ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet27e01 |
|---|---|
| Clone Library Name | barley_pub |
>CB13_LYCES (P27522) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCI type III CAB-8) Length = 273 Score = 95.9 bits (237), Expect = 2e-20 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = +1 Query: 175 FVVRASSTPPAKQNDNRQLWFASKQSLTYLDGTLPGDFGFDPLGLSDPEG 324 FVVRA+STPP KQ NRQLWFASKQSL+YLDG LPGDFGFDPLGLSDPEG Sbjct: 37 FVVRAASTPPVKQGANRQLWFASKQSLSYLDGRLPGDFGFDPLGLSDPEG 86
>CB12_LYCES (P10708) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCI type II CAB-7) Length = 270 Score = 51.6 bits (122), Expect = 5e-07 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Frame = +1 Query: 184 RASSTPPAKQNDNRQLWFASKQSLTYLDGTLPGDFGFDPLGL-SDPE 321 R+++T + +R LWF +LDG+LPGDFGFDPLGL SDPE Sbjct: 52 RSATTVCVAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPE 98
>CB12_PETHY (P13869) Chlorophyll a-b binding protein, chloroplast precursor| (LHCI type II CAB) Length = 270 Score = 50.1 bits (118), Expect = 1e-06 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = +1 Query: 172 PFVVRASSTPPAKQNDNRQLWFASKQSLTYLDGTLPGDFGFDPLGL-SDPE 321 P R+ + + +R LWF +LDG+LPGDFGFDPLGL SDPE Sbjct: 48 PVGSRSVAVSAVAADPDRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPE 98
>CB4B_ARATH (Q9XF88) Chlorophyll a-b binding protein CP29.2, chloroplast| precursor (LHCII protein 4.2) (LHCB4.2) Length = 287 Score = 45.8 bits (107), Expect = 3e-05 Identities = 19/33 (57%), Positives = 23/33 (69%) Frame = +1 Query: 220 NRQLWFASKQSLTYLDGTLPGDFGFDPLGLSDP 318 +R LWF +S YLDG+L GD+GFDP GL P Sbjct: 51 DRPLWFPGAKSPEYLDGSLVGDYGFDPFGLGKP 83
>CB29_CHLRE (Q93WD2) Chlorophyll a-b binding protein CP29| Length = 279 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +1 Query: 229 LWFASKQSLTYLDGTLPGDFGFDPLGLSDP 318 LW + +LDG+LPGD GFDPLGLS P Sbjct: 51 LWLPNTTRPEWLDGSLPGDRGFDPLGLSKP 80
>CB4A_ARATH (Q07473) Chlorophyll a-b binding protein CP29.1, chloroplast| precursor (LHCII protein 4.1) (LHCB4.1) Length = 290 Score = 41.2 bits (95), Expect = 7e-04 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = +1 Query: 220 NRQLWFASKQSLTYLDGTLPGDFGFDPLGLSDP 318 +R LW+ S +LDG+L GD+GFDP GL P Sbjct: 54 DRPLWYPGAISPDWLDGSLVGDYGFDPFGLGKP 86
>CB4B_LYCES (P27525) Chlorophyll a-b binding protein CP24 10B, chloroplast| precursor (CAB-10B) (LHCP) Length = 256 Score = 40.4 bits (93), Expect = 0.001 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 7/55 (12%) Frame = +1 Query: 175 FVVRASSTPPAKQNDNRQLWFASKQS------LTYLDGTLPGDFGFDPLGL-SDP 318 FVV A++ P K W + +S +LDG+LPGDFGFDPLGL DP Sbjct: 42 FVVAAAAVAPKKS------WIPAVKSGGNLVDPEWLDGSLPGDFGFDPLGLGKDP 90
>CB11_LYCES (P12360) Chlorophyll a-b binding protein 6A, chloroplast precursor| (LHCI type I CAB-6A) (Light-harvesting complex I 26 kDa protein) Length = 246 Score = 38.5 bits (88), Expect = 0.004 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 232 WFASKQSLTYLDGTLPGDFGFDPLGLSD 315 W + +YLDG+ PGDFGFD LGL + Sbjct: 49 WMPGQPRPSYLDGSAPGDFGFDSLGLGE 76
>CB4_SPIOL (P36494) Chlorophyll a-b binding protein CP24, chloroplast| precursor Length = 261 Score = 38.5 bits (88), Expect = 0.004 Identities = 17/21 (80%), Positives = 19/21 (90%), Gaps = 1/21 (4%) Frame = +1 Query: 259 YLDGTLPGDFGFDPLGL-SDP 318 +LDG+LPGDFGFDPLGL DP Sbjct: 75 WLDGSLPGDFGFDPLGLGKDP 95
>CB4C_ARATH (Q9S7W1) Chlorophyll a-b binding protein CP29.3, chloroplast| precursor (LHCII protein 4.3) (LHCB4.3) Length = 276 Score = 38.1 bits (87), Expect = 0.006 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 5/53 (9%) Frame = +1 Query: 175 FVVRASSTPPAK----QND-NRQLWFASKQSLTYLDGTLPGDFGFDPLGLSDP 318 F + + PP K Q+D +R +WF +LDG++ GD GFDP GL P Sbjct: 35 FGKKKPAPPPKKSRQVQDDGDRLVWFPGANPPEWLDGSMIGDRGFDPFGLGKP 87
>CB4A_LYCES (P27524) Chlorophyll a-b binding protein CP24 10A, chloroplast| precursor (CAB-10A) (LHCP) Length = 256 Score = 37.4 bits (85), Expect = 0.009 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 1/21 (4%) Frame = +1 Query: 259 YLDGTLPGDFGFDPLGL-SDP 318 +LDG+LPGD+GFDPLGL DP Sbjct: 70 WLDGSLPGDYGFDPLGLGKDP 90
>CB24_ARATH (P27521) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCI type III CAB-4) (LHCP) Length = 251 Score = 36.6 bits (83), Expect = 0.016 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 187 ASSTPPAKQNDNRQLWFASKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 ++ T K + W S YL G+L GD GFDPLGL+ DPE Sbjct: 42 SAKTSSFKVEAKKGEWLPGLASPDYLTGSLAGDNGFDPLGLAEDPE 87
>CB23_NICPL (P12469) Chlorophyll a-b binding protein C, chloroplast precursor| (LHCII type I CAB-C) (LHCP) Length = 267 Score = 35.4 bits (80), Expect = 0.036 Identities = 21/46 (45%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +1 Query: 187 ASSTPPAKQNDNRQLWFASKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 +SS+P N + L S +S +YL G PGD+G+D GLS DPE Sbjct: 46 SSSSPWYGPNRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPE 91
>CB21_PEA (P04159) Chlorophyll a-b binding protein AB96 (LHCII type I| CAB-AB96) (LHCP) (Major 15) (Fragment) Length = 228 Score = 35.0 bits (79), Expect = 0.047 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +1 Query: 181 VRASSTPPAKQNDNRQLWFASKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 V +SS+P + + L S +S +YL G PGD+G+D GLS DPE Sbjct: 5 VASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPE 52
>CB22_TOBAC (P27493) Chlorophyll a-b binding protein 21, chloroplast precursor| (LHCII type I CAB-21) (LHCP) Length = 265 Score = 34.7 bits (78), Expect = 0.061 Identities = 21/46 (45%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +1 Query: 187 ASSTPPAKQNDNRQLWFASKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 ASS+P + + L S +S +YL G PGD+G+D GLS DPE Sbjct: 44 ASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPE 89
>CB26_PETSP (P12062) Chlorophyll a-b binding protein 37, chloroplast precursor| (LHCII type I CAB-37) (LHCP) Length = 265 Score = 34.3 bits (77), Expect = 0.080 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S+Q+ +YL G PGD+G+D GLS DPE Sbjct: 62 SEQTPSYLTGEFPGDYGWDTAGLSADPE 89
>CB24_LYCES (P14278) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCII type I CAB-4) (LHCP) Length = 265 Score = 34.3 bits (77), Expect = 0.080 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S+Q+ +YL G PGD+G+D GLS DPE Sbjct: 62 SEQTPSYLTGEFPGDYGWDTAGLSADPE 89
>CB23_TOBAC (P27494) Chlorophyll a-b binding protein 36, chloroplast precursor| (LHCII type I CAB-36) (LHCP) Length = 265 Score = 34.3 bits (77), Expect = 0.080 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S+Q+ +YL G PGD+G+D GLS DPE Sbjct: 62 SEQTPSYLTGEFPGDYGWDTAGLSADPE 89
>CB23_POLMU (P15195) Chlorophyll a-b binding protein type 1 member F3,| chloroplast precursor (DE Chlorophyll a-b binding protein type I F3) (CAB-F3) (LHCP) Length = 265 Score = 34.3 bits (77), Expect = 0.080 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 11/57 (19%) Frame = +1 Query: 184 RASSTPPAKQNDNRQLWFASKQSL----------TYLDGTLPGDFGFDPLGLS-DPE 321 R P + + +W+ S + L +YL G PGD+G+D GLS DPE Sbjct: 33 RVQMMAPKSKAPSGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDYGWDTAGLSADPE 89
>CB23_LYCES (P27489) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type III CAB-13) Length = 265 Score = 34.3 bits (77), Expect = 0.080 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S Q+ +YL+G PGD+G+D GLS DPE Sbjct: 60 SAQTPSYLNGEFPGDYGWDTAGLSADPE 87
>CB25_LYCES (P14279) Chlorophyll a-b binding protein 5, chloroplast precursor| (LHCII type I CAB-5) (LHCP) (Fragment) Length = 237 Score = 34.3 bits (77), Expect = 0.080 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S+Q+ +YL G PGD+G+D GLS DPE Sbjct: 34 SEQTPSYLTGEFPGDYGWDTAGLSADPE 61
>CB23_ORYSA (P27519) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 263 Score = 34.3 bits (77), Expect = 0.080 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S+Q+ +YL G PGD+G+D GLS DPE Sbjct: 60 SEQTPSYLTGEFPGDYGWDTAGLSADPE 87
>CB21_LEMGI (P12328) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 264 Score = 34.3 bits (77), Expect = 0.080 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S+Q+ +YL G PGD+G+D GLS DPE Sbjct: 61 SEQTPSYLTGEFPGDYGWDTAGLSADPE 88
>CB23_HORVU (P27523) Chlorophyll a-b binding protein of LHCII type III,| chloroplast precursor (CAB) Length = 268 Score = 34.3 bits (77), Expect = 0.080 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S Q+ +YL+G PGD+G+D GLS DPE Sbjct: 63 SAQTPSYLNGEFPGDYGWDTAGLSADPE 90
>CB21_SILPR (P12332) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 205 Score = 34.3 bits (77), Expect = 0.080 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S+Q+ +YL G PGD+G+D GLS DPE Sbjct: 61 SEQTPSYLTGEFPGDYGWDTAGLSADPE 88
>CB21_WHEAT (P04784) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 266 Score = 33.9 bits (76), Expect = 0.10 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 11/50 (22%) Frame = +1 Query: 205 AKQNDNRQLWFASKQSL----------TYLDGTLPGDFGFDPLGLS-DPE 321 AKQ + W+ S + L +YL G PGD+G+D GLS DPE Sbjct: 41 AKQVSSSSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPE 90
>LH18_EUGGR (P08976) Light-harvesting complex I LH38 proteins precursor| [Contains: LH38 protein 1; LH38 protein 2; LH38 protein 3] (Fragment) Length = 530 Score = 33.9 bits (76), Expect = 0.10 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 217 DNRQLWFASKQSLTYLDGTLPGDFGFDPLGL-SDP 318 + R+LWF + YL G GD GFDP GL +DP Sbjct: 369 EERELWFPNIVPPRYLTGEAYGDKGFDPAGLAADP 403 Score = 32.3 bits (72), Expect = 0.30 Identities = 15/32 (46%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = +1 Query: 229 LWFASKQSLTYLDGTLPGDFGFDPLGL-SDPE 321 LWF + + ++L+G GD GFDP GL +DP+ Sbjct: 4 LWFPNTLAPSWLNGEYYGDRGFDPAGLAADPD 35 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 229 LWFASKQSLTYLDGTLPGDFGFDPLGL-SDPE 321 LWF + + L G P D GFDPL L +DP+ Sbjct: 189 LWFPNAEPPALLTGEYPADRGFDPLNLAADPD 220
>CB2B_LYCES (P07370) Chlorophyll a-b binding protein 1B, chloroplast precursor| (LHCII type I CAB-1B) (LHCP) Length = 265 Score = 33.1 bits (74), Expect = 0.18 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S +S +YL G PGD+G+D GLS DPE Sbjct: 62 SGESPSYLTGEFPGDYGWDTAGLSADPE 89
>CB23_PEA (P27520) Chlorophyll a-b binding protein 215, chloroplast precursor| (LHCII type II CAB-215) (LHCP) Length = 265 Score = 33.1 bits (74), Expect = 0.18 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S+Q +YL G PGD+G+D GLS DPE Sbjct: 62 SEQIPSYLTGEFPGDYGWDTAGLSADPE 89
>CB25_NICPL (P12470) Chlorophyll a-b binding protein E, chloroplast precursor| (LHCII type I CAB-E) (LHCP) Length = 266 Score = 33.1 bits (74), Expect = 0.18 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S +S +YL G PGD+G+D GLS DPE Sbjct: 63 SGESPSYLTGEFPGDYGWDTAGLSADPE 90
>CB21_TOBAC (P27492) Chlorophyll a-b binding protein 16, chloroplast precursor| (LHCII type I CAB-16) (LHCP) Length = 266 Score = 33.1 bits (74), Expect = 0.18 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S +S +YL G PGD+G+D GLS DPE Sbjct: 63 SGESPSYLTGEFPGDYGWDTAGLSADPE 90
>CB22_HORVU (P08963) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 264 Score = 33.1 bits (74), Expect = 0.18 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S +S +YL G PGD+G+D GLS DPE Sbjct: 61 SGESPSYLTGEFPGDYGWDTAGLSADPE 88
>CB28_PEA (P27490) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCII type I CAB-8) Length = 268 Score = 33.1 bits (74), Expect = 0.18 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S +S +YL G PGD+G+D GLS DPE Sbjct: 65 SGESPSYLTGEFPGDYGWDTAGLSADPE 92
>CB2G_LYCES (P07369) Chlorophyll a-b binding protein 3C, chloroplast precursor| (LHCII type I CAB-3C) (LHCP) Length = 267 Score = 33.1 bits (74), Expect = 0.18 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S +S +YL G PGD+G+D GLS DPE Sbjct: 64 SGESPSYLTGEFPGDYGWDTAGLSADPE 91
>CB2A_SPIOL (P12333) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 267 Score = 33.1 bits (74), Expect = 0.18 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S +S +YL G PGD+G+D GLS DPE Sbjct: 64 SGESPSYLTGEFPGDYGWDTAGLSADPE 91
>CB25_TOBAC (P27496) Chlorophyll a-b binding protein 50, chloroplast precursor| (LHCII type I CAB-50) (LHCP) Length = 267 Score = 33.1 bits (74), Expect = 0.18 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S +S +YL G PGD+G+D GLS DPE Sbjct: 64 SGESPSYLTGEFPGDYGWDTAGLSADPE 91
>CB24_TOBAC (P27495) Chlorophyll a-b binding protein 40, chloroplast precursor| (LHCII type I CAB-40) (LHCP) Length = 267 Score = 33.1 bits (74), Expect = 0.18 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S +S +YL G PGD+G+D GLS DPE Sbjct: 64 SGESPSYLTGEFPGDYGWDTAGLSADPE 91
>CB22_PEA (P07371) Chlorophyll a-b binding protein AB80, chloroplast| precursor (LHCII type I CAB-AB80) (LHCP) Length = 269 Score = 33.1 bits (74), Expect = 0.18 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S +S +YL G PGD+G+D GLS DPE Sbjct: 66 SGESPSYLTGEFPGDYGWDTAGLSADPE 93
>CB22_ARATH (P04778) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (CAB-140) (LHCP) Length = 267 Score = 33.1 bits (74), Expect = 0.18 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S +S +YL G PGD+G+D GLS DPE Sbjct: 63 SGESPSYLTGEFPGDYGWDTAGLSADPE 90
>CB21_ARATH (P04777) Chlorophyll a-b binding protein 165/180, chloroplast| precursor (LHCII type I CAB-165/180) Length = 267 Score = 33.1 bits (74), Expect = 0.18 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S +S +YL G PGD+G+D GLS DPE Sbjct: 63 SGESPSYLTGEFPGDYGWDTAGLSADPE 90
>CB2_CHLRE (P14273) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 253 Score = 33.1 bits (74), Expect = 0.18 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 4/38 (10%) Frame = +1 Query: 220 NRQLW---FASKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 NR W ++ + YL G PGD+G+D GLS DPE Sbjct: 40 NRAKWLGPYSENATPAYLTGEFPGDYGWDTAGLSADPE 77
>MOD5_HUMAN (Q9H3H1) tRNA isopentenyltransferase, mitochondrial precursor (EC| 2.5.1.8) (Isopentenyl-diphosphate:tRNA isopentenyltransferase) (IPP transferase) (IPTase) (IPPT) (hGRO1) Length = 467 Score = 32.7 bits (73), Expect = 0.23 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = -3 Query: 291 AKVTRQRAVEVGEGLLGREPQLPVVILLGRGG 196 A V RAV VG GL G + LP+V++LG G Sbjct: 2 ASVAAARAVPVGSGLRGLQRTLPLVVILGATG 33
>CB21_GOSHI (P27518) Chlorophyll a-b binding protein 151, chloroplast precursor| (LHCII type II CAB-151) (LHCP) Length = 265 Score = 32.3 bits (72), Expect = 0.30 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S Q +YL G PGD+G+D GLS DPE Sbjct: 62 SDQIPSYLTGEFPGDYGWDTAGLSADPE 89
>CB21_MAIZE (P12329) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 262 Score = 32.3 bits (72), Expect = 0.30 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +1 Query: 181 VRASSTPPAKQNDNRQLWFASKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 V AS +P + + L S + +YL G PGD+G+D GLS DPE Sbjct: 39 VAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE 86
>CB24_PETSP (P04782) Chlorophyll a-b binding protein 25, chloroplast precursor| (LHCII type I CAB-25) (LHCP) Length = 266 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/28 (53%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S ++ +YL G PGD+G+D GLS DPE Sbjct: 63 SGEAPSYLTGEFPGDYGWDTAGLSADPE 90
>CB23_APIGR (P92919) Chlorophyll a-b binding protein, chloroplast precursor| (Allergen Api g 3) Length = 264 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/28 (53%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S ++ +YL G PGD+G+D GLS DPE Sbjct: 61 SGEAPSYLTGEFPGDYGWDTAGLSADPE 88
>CB27_TOBAC (P27491) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCII type I CAB-7) (LHCP) Length = 267 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/28 (53%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S ++ +YL G PGD+G+D GLS DPE Sbjct: 64 SGEAPSYLTGEFPGDYGWDTAGLSADPE 91
>CB22_PETSP (P04780) Chlorophyll a-b binding protein 22L, chloroplast precursor| (LHCII type I CAB-22L) (LHCP) Length = 267 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/28 (53%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S ++ +YL G PGD+G+D GLS DPE Sbjct: 64 SGEAPSYLTGEFPGDYGWDTAGLSADPE 91
>CB2_CHLMO (P22686) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 256 Score = 31.6 bits (70), Expect = 0.52 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +1 Query: 220 NRQLWFA--SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 +R W S + YL G PGD+G+D GLS DPE Sbjct: 43 DRAKWLGPFSTNTPAYLTGEFPGDYGWDTAGLSADPE 79
>CB29_MAIZE (P27497) Chlorophyll a-b binding protein M9, chloroplast precursor| (LHCII type I CAB-M9) (LHCP) Length = 265 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 256 TYLDGTLPGDFGFDPLGLS-DPE 321 +YL G PGD+G+D GLS DPE Sbjct: 67 SYLTGEFPGDYGWDTAGLSADPE 89
>CB22_MAIZE (P06671) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 265 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 256 TYLDGTLPGDFGFDPLGLS-DPE 321 +YL G PGD+G+D GLS DPE Sbjct: 67 SYLTGEFPGDYGWDTAGLSADPE 89
>CB21_ORYSA (P12330) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 265 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 256 TYLDGTLPGDFGFDPLGLS-DPE 321 +YL G PGD+G+D GLS DPE Sbjct: 67 SYLTGEFPGDYGWDTAGLSADPE 89
>CB23_SOYBN (P09756) Chlorophyll a-b binding protein 3, chloroplast precursor| (LHCII type I CAB-3) (LHCP) Length = 263 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 256 TYLDGTLPGDFGFDPLGLS-DPE 321 +YL G PGD+G+D GLS DPE Sbjct: 65 SYLTGEFPGDYGWDTAGLSADPE 87
>CB21_SINAL (P13851) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 266 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 256 TYLDGTLPGDFGFDPLGLS-DPE 321 +YL G PGD+G+D GLS DPE Sbjct: 67 SYLTGEFPGDYGWDTAGLSADPE 89
>CB2A_PYRPY (P24006) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type II CAB-1A) (LHCP) Length = 278 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 256 TYLDGTLPGDFGFDPLGLS-DPE 321 +YL G PGD+G+D GLS DPE Sbjct: 80 SYLTGEFPGDYGWDTAGLSADPE 102
>CB2A_PINSY (P15193) Chlorophyll a-b binding protein type 2 member 1A,| chloroplast precursor (Chlorophyll a-b binding protein type II 1A) (CAB) (LHCP) Length = 278 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 256 TYLDGTLPGDFGFDPLGLS-DPE 321 +YL G PGD+G+D GLS DPE Sbjct: 80 SYLTGEFPGDYGWDTAGLSADPE 102
>CB21_SOYBN (P12471) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 245 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 256 TYLDGTLPGDFGFDPLGLS-DPE 321 +YL G PGD+G+D GLS DPE Sbjct: 47 SYLTGEFPGDYGWDTAGLSADPE 69
>CB21_CUCSA (P08221) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) (Fragment) Length = 255 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 256 TYLDGTLPGDFGFDPLGLS-DPE 321 +YL G PGD+G+D GLS DPE Sbjct: 57 SYLTGEFPGDYGWDTAGLSADPE 79
>CB22_ORYSA (P12331) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 261 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 256 TYLDGTLPGDFGFDPLGLS-DPE 321 +YL G PGD+G+D GLS DPE Sbjct: 63 SYLTGEFPGDYGWDTAGLSADPE 85
>CB2B_PINSY (P15194) Chlorophyll a-b binding protein type 2 member 1B,| chloroplast precursor (Chlorophyll a-b binding protein type II 1B) (CAB) (LHCP) Length = 274 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 256 TYLDGTLPGDFGFDPLGLS-DPE 321 +YL G PGD+G+D GLS DPE Sbjct: 76 SYLTGEFPGDYGWDTAGLSADPE 98
>CB2_DUNTE (P27517) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 253 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 235 FASKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 F+ + YL G PGD+G+D GLS DP+ Sbjct: 45 FSENDTPEYLTGEFPGDYGWDTAGLSADPQ 74
>CB22_CUCSA (P08222) Chlorophyll a-b binding protein of LHCII type 1| (Chlorophyll a-b binding protein of LHCII type I) (CAB) (LHCP) (Fragment) Length = 206 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 256 TYLDGTLPGDFGFDPLGLS-DPE 321 +YL G PGD+G+D GLS DPE Sbjct: 8 SYLTGEFPGDYGWDTAGLSADPE 30
>LH15_EUGGR (P08975) Light-harvesting complex I LH35 proteins precursor| [Contains: LH35 protein 1; LH35 protein 2] (Fragment) Length = 331 Score = 30.8 bits (68), Expect = 0.89 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +1 Query: 229 LWFASKQSLTYLDGTLPGDFGFDPLGL-SDP 318 +WF Q +L G P D GFDPL + +DP Sbjct: 161 VWFPGAQPPAHLTGEYPADRGFDPLSVAADP 191
>FCP_ISOGA (Q39709) Fucoxanthin-chlorophyll a-c binding protein, chloroplast| precursor (FCP) Length = 208 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +1 Query: 265 DGTLPGDFGFDPLGL--SDPE 321 +G PGD GFDPLGL SDP+ Sbjct: 145 EGYEPGDLGFDPLGLAPSDPD 165
>CB48_MAIZE (Q00827) Chlorophyll a-b binding protein 48, chloroplast precursor| (LHCII type I CAB-48) (LHCP) Length = 264 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 256 TYLDGTLPGDFGFDPLGLS-DPE 321 +YL G PGD+G+D GLS DPE Sbjct: 66 SYLTGEFPGDYGWDTEGLSADPE 88
>CB21_PETSP (P04779) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type I CAB-13) (LHCP) Length = 266 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/27 (51%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DP 318 S ++ +YL G PGD+G+D GLS DP Sbjct: 63 SGEAPSYLTGEFPGDYGWDTAGLSADP 89
>CB23_PETSP (P04781) Chlorophyll a-b binding protein 22R, chloroplast precursor| (LHCII type I CAB-22R) (LHCP) Length = 267 Score = 30.0 bits (66), Expect = 1.5 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +1 Query: 187 ASSTPPAKQNDNRQLWFASKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 +SS+P + + L S ++ +YL G P D+G+D GLS DPE Sbjct: 46 SSSSPWYGPDRVKYLGPFSGEAPSYLTGEFPSDYGWDTAGLSADPE 91
>CB2_PHYPA (P20866) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 269 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGL-SDPE 321 S ++ +YL+G GD+G+D GL SDPE Sbjct: 65 SGETPSYLNGEFAGDYGWDTAGLSSDPE 92
>SYE1_WOLPM (Q73HV5) Glutamyl-tRNA synthetase 1 (EC 6.1.1.17) (Glutamate--tRNA| ligase 1) (GluRS 1) Length = 473 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -1 Query: 194 DDALTTKGDFREEDDLEKEDCRGLPSSCLPERRPW 90 D+ K REE + K C P SC P R W Sbjct: 104 DEVAEKKAKAREEGKIYKHKCTTKPPSCHPSSRHW 138
>CB26_ARATH (Q9XF89) Chlorophyll a-b binding protein CP26, chloroplast| precursor (Light-harvesting complex II protein 5) (LHCB5) (LHCIIc) Length = 280 Score = 29.3 bits (64), Expect = 2.6 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 Query: 259 YLDGTLPGDFGFDPLGL 309 YL+G + GD+G+DP GL Sbjct: 84 YLNGEVAGDYGYDPFGL 100
>CB2_MALDO (P15773) Chlorophyll a-b binding protein AB10, chloroplast| precursor (LHCII type I CAB-AB10) (LHCP) Length = 268 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 256 TYLDGTLPGDFGFDPLGLS 312 +YL G PGD+G+D GLS Sbjct: 71 SYLTGEFPGDYGWDTAGLS 89
>CB25_PETSP (P04783) Chlorophyll a-b binding protein 91R, chloroplast precursor| (LHCII type I CAB-91R) (LHCP) Length = 267 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S ++ +YL G PGD+G+D LS DPE Sbjct: 64 SGEAPSYLTGEFPGDYGWDTAELSADPE 91
>CB21_PINTH (P10049) Chlorophyll a-b binding protein type I, chloroplast| precursor (CAB) (LHCP) Length = 266 Score = 28.1 bits (61), Expect = 5.7 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 241 SKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 S+ + +YL G PGD+G+D +S DPE Sbjct: 63 SEGTPSYLTGEFPGDYGWDTAAVSADPE 90
>OMPY_CHLPN (Q9Z6M5) Putative outer membrane protein| CPn_1034/CP0818/CPj1034/CpB1074 precursor Length = 262 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -1 Query: 218 SFCLAGGVDDALTTKGDFREEDDLEKEDCRGLPSSCLPERRPWAAIVP 75 +F L +DD L G+ + + +GL PE+ W A+VP Sbjct: 41 NFWLILDLDDTLLQGGEALSHSIWKSKAIQGLQKQGTPEQEAWEAVVP 88
>VNUA_PRVKA (P33485) Probable nuclear antigen| Length = 1733 Score = 27.7 bits (60), Expect = 7.5 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -3 Query: 318 RVGQPQGVEAKVTRQRAVEVGEGLLGREPQ-LPVVILLGRGGG 193 R+G P+ V VG G+LG P+ P ++LG GGG Sbjct: 845 RLGGPRRVGLAGRDAAEAAVGRGVLGHGPERAPEPVVLGGGGG 887
>SYV_SYNEL (Q8DIS8) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 913 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 190 SSTPPAKQNDNRQLWFASKQSLTYLDGTLPGDFG 291 S+T A +N +LW AS+ L L+G PG G Sbjct: 590 SATVEAARNFANKLWNASRFVLLNLEGQTPGQLG 623
>CB2_DUNSA (P20865) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 273 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +1 Query: 232 WFASKQSLTYLDGTLPGDFGFDPLGLS-DPE 321 W Q G PGD+G+D GLS DPE Sbjct: 66 WDLQHQHPRLPTGEFPGDYGWDTAGLSADPE 96 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.131 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,482,553 Number of Sequences: 219361 Number of extensions: 556079 Number of successful extensions: 1295 Number of sequences better than 10.0: 77 Number of HSP's better than 10.0 without gapping: 1284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1295 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)
