| Clone Name | baet24d02 |
|---|---|
| Clone Library Name | barley_pub |
>CRCB_NEIMB (Q9JZG6) Protein crcB homolog| Length = 119 Score = 30.8 bits (68), Expect = 1.4 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +2 Query: 200 LGMAARKLANHAIVXXXXXXXXRHFLKWL-AFIAAVYLLVLDRTNWKTNMLTGLL 361 LG AR L N A+ F W+ AF+ ++ ++ WK ++TG L Sbjct: 14 LGATARWLLNLAVPASIPPATGNLFANWIGAFLIGIFAETVNHPQWKLLLITGFL 68
>CRCB_NEIMA (Q9JUL1) Protein crcB homolog| Length = 119 Score = 30.4 bits (67), Expect = 1.8 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +2 Query: 200 LGMAARKLANHAIVXXXXXXXXRHFLKWL-AFIAAVYLLVLDRTNWKTNMLTGLL 361 LG AR L N A+ F W AF+ ++ ++ WK ++TG L Sbjct: 14 LGATARWLLNLAVPASLSPATGNLFANWTGAFLIGIFAETVNHPQWKLLLITGFL 68
>TIO_ATHV3 (Q9YJQ8) Protein tio| Length = 269 Score = 28.9 bits (63), Expect = 5.1 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 49 ELDPHSARLEIFPGLGDSGEDGPV-VPRD 132 E H FP LGDSGE+GP +P+D Sbjct: 4 EPQEHEEGKPFFPPLGDSGEEGPPNIPQD 32
>RB6I2_MOUSE (Q99MI1) RAB6-interacting protein 2 (ERC protein 1) (ERC1)| (CAZ-associated structural protein 2) (CAST2) Length = 1120 Score = 28.5 bits (62), Expect = 6.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 4 TNQTPSPRPSIHPCAELDPHSARLEIFPG 90 TN PSP I P ELD + ++L+++ G Sbjct: 1004 TNHKPSPDQIIQPLLELDQNRSKLKLYIG 1032
>YNI7_YEAST (P48231) Hypothetical 132.5 kDa protein in TOP2-MKT1 intergenic| region Length = 1178 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 1 STNQTPSPRPSIHPCAELDPHSARLEIFPGLGDSGEDGPVV 123 STN S ++ P + +DP S P +G GEDG V+ Sbjct: 1059 STNSNRSIGKAVVPLSTIDPESDTTFNIPLVGPKGEDGGVL 1099
>RB6I2_HUMAN (Q8IUD2) RAB6-interacting protein 2 (ERC protein 1)| Length = 1116 Score = 28.5 bits (62), Expect = 6.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 4 TNQTPSPRPSIHPCAELDPHSARLEIFPG 90 TN PSP I P ELD + ++L+++ G Sbjct: 1000 TNHKPSPDQIIQPLLELDQNRSKLKLYIG 1028
>FOXD4_MOUSE (Q60688) Forkhead box protein D4 (Forkhead-related protein FKHL9)| (Forkhead-related transcription factor 5) (FREAC-5) (Transcription factor FKH-2) Length = 444 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +1 Query: 16 PSPRPSIHPCAELDPHSAR--LEIFPGLGDS 102 P+ P HPCA L PH R L P GD+ Sbjct: 246 PAAPPRSHPCAPLHPHPMRYLLLAAPAYGDN 276
>AGAR_STRCO (P07883) Extracellular agarase precursor (EC 3.2.1.81)| Length = 309 Score = 28.1 bits (61), Expect = 8.8 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 337 DQHADGTLGPLHFLHPARRAFLSD 408 DQH DG GP + L+ AR ++++D Sbjct: 75 DQHKDGWSGPANSLYSARHSWVAD 98 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.142 0.459 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,837,506 Number of Sequences: 219361 Number of extensions: 644526 Number of successful extensions: 2260 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2259 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)