| Clone Name | baet23g06 |
|---|---|
| Clone Library Name | barley_pub |
>SIN3A_HUMAN (Q96ST3) Paired amphipathic helix protein Sin3a (Transcriptional| corepressor Sin3a) (Histone deacetylase complex subunit Sin3a) Length = 1273 Score = 29.6 bits (65), Expect = 2.0 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = -2 Query: 273 HQTTLYGSQPTPQPNPRHNGMAVAGSTVDSRN*CCSPPDRRRVSESQ 133 HQ +G QP PQP P+H A S PP + SQ Sbjct: 209 HQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQ 255
>XRN1_YEAST (P22147) 5'-3' exoribonuclease 1 (EC 3.1.11.-) (Strand exchange| protein 1) (KAR(-)-enhancing mutation protein) (5'-3' exoribonuclease) (DNA strand transfer protein beta) (STP-beta) (p175) Length = 1528 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -2 Query: 291 PPARMTHQTTLYGSQPTPQPNPRHNGMAV 205 PP MTH L+ P P P NGM++ Sbjct: 1402 PPGFMTHPNGLHPLHPHQMPYPNMNGMSI 1430
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 28.5 bits (62), Expect = 4.4 Identities = 19/58 (32%), Positives = 23/58 (39%) Frame = -2 Query: 321 AAHARRQLTKPPARMTHQTTLYGSQPTPQPNPRHNGMAVAGSTVDSRN*CCSPPDRRR 148 ++ RR + PPAR + P P P PR T R SPP RRR Sbjct: 555 SSRRRRSPSPPPARRRRSPSPAPPPPPPPPPPRRR----RSPTPPPRRRTPSPPPRRR 608
>SIN3A_MOUSE (Q60520) Paired amphipathic helix protein Sin3a (Transcriptional| corepressor Sin3a) (Histone deacetylase complex subunit Sin3a) Length = 1282 Score = 27.7 bits (60), Expect = 7.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 273 HQTTLYGSQPTPQPNPRH 220 HQ +G QP PQP P+H Sbjct: 209 HQIPTHGIQPQPQPPPQH 226
>LEP4_PECCC (P31712) Type 4 prepilin-like proteins leader peptide-processing| enzyme (Pectic enzymes secretion protein outO) [Includes: Leader peptidase (EC 3.4.23.43) (Prepilin peptidase); N-methyltransferase (EC 2.1.1.-)] Length = 279 Score = 27.3 bits (59), Expect = 9.9 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +1 Query: 115 KSVKLSLRLADPSS---VWGAATSVPRIYGAASHRHSIVPWIWLWRGLGTVQCC 267 + ++L +ADP + +W +S P A + + +I + WLW G +CC Sbjct: 47 QDIELETGVADPDTRYNLWWPPSSCPHCQQAIAVKDNIPLFSWLWL-RGRSRCC 99
>APC_RAT (P70478) Adenomatous polyposis coli protein (Protein APC)| Length = 2842 Score = 27.3 bits (59), Expect = 9.9 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = -3 Query: 257 TVPSPRH---NQIQGTMEWRWLAAP*IRGTDVAAPQTDDGSASRNESLTDLF 111 +VP PR NQ+ WR + I T+ + T G+AS ES T ++ Sbjct: 2594 SVPGPRQMKENQVPTKGTWRKIKESEISPTNTVSQTTSSGAASGAESKTLIY 2645 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,663,749 Number of Sequences: 219361 Number of extensions: 775851 Number of successful extensions: 2641 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2635 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)