| Clone Name | baet23f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GP107_HUMAN (Q5VW38) Protein GPR107 precursor (Lung seven transm... | 33 | 0.36 | 2 | GP107_MOUSE (Q8BUV8) Protein GPR107 precursor | 31 | 1.8 | 3 | RM19_CAEEL (Q95Y83) Probable 39S ribosomal protein L19, mitochon... | 29 | 6.8 |
|---|
>GP107_HUMAN (Q5VW38) Protein GPR107 precursor (Lung seven transmembrane| receptor 1) Length = 600 Score = 33.1 bits (74), Expect = 0.36 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 7/79 (8%) Frame = +1 Query: 211 IRSTAIRGDPRTIIPLDEFGFSRHGVLELNVSGIAFDPPASQD------LDLSQFGFFLS 372 + A++ D R + L+ FGF + G + +NVS ++ + P +D LD ++ F S Sbjct: 41 VHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSS 100 Query: 373 TLDAWV-HVLRQLQDLEVT 426 LD V + + + Q + VT Sbjct: 101 YLDEDVNYCILKKQSVSVT 119
>GP107_MOUSE (Q8BUV8) Protein GPR107 precursor| Length = 551 Score = 30.8 bits (68), Expect = 1.8 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = +1 Query: 211 IRSTAIRGDPRTIIPLDEFGFSRHGVLELNVSGIAFDPPASQDLDLSQFGFFL 369 + A++ D R + L+ FGF + G + +NVS ++ + P ++ GF L Sbjct: 35 VHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSVNEPEGATDKDAEIGFSL 87
>RM19_CAEEL (Q95Y83) Probable 39S ribosomal protein L19, mitochondrial| precursor Length = 288 Score = 28.9 bits (63), Expect = 6.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 377 RVERKKPNWERSRSWEAGGSKAMPETLSSSTPW 279 +V+ K P W +R WE + + +T + +TPW Sbjct: 195 KVKLKTPPW--TRRWEVASVRGIEDTWTQATPW 225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,388,408 Number of Sequences: 219361 Number of extensions: 422875 Number of successful extensions: 1562 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1562 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)