| Clone Name | baet23b11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FCA_ARATH (O04425) Flowering time control protein FCA | 30 | 3.0 | 2 | SENP3_MOUSE (Q9EP97) Sentrin-specific protease 3 (EC 3.4.22.-) (... | 28 | 6.7 | 3 | RIMS1_HUMAN (Q86UR5) Regulating synaptic membrane exocytosis pro... | 28 | 8.8 | 4 | NFAC4_HUMAN (Q14934) Nuclear factor of activated T-cells, cytopl... | 28 | 8.8 |
|---|
>FCA_ARATH (O04425) Flowering time control protein FCA| Length = 747 Score = 29.6 bits (65), Expect = 3.0 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 29 EREKKRWGFGKSFREKDPVRPPTPPVQRAAT-PRRTYAASDDG 154 E +R GK+ VRP TPPVQ+ + +R Y SD G Sbjct: 64 ESPDRRRFIGKAMESDYSVRPTTPPVQQPLSGQKRGYPISDHG 106
>SENP3_MOUSE (Q9EP97) Sentrin-specific protease 3 (EC 3.4.22.-)| (Sentrin/SUMO-specific protease SENP3) (SUMO-1-specific protease 3) (Smt3-specific isopeptidase 1) (Smt3ip1) Length = 568 Score = 28.5 bits (62), Expect = 6.7 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 7/64 (10%) Frame = +2 Query: 2 GPVSGDHKPEREKKRWGFGKSFREK-------DPVRPPTPPVQRAATPRRTYAASDDGGD 160 GP + P RE+ RW R K DP T P +R PR ++ AS + Sbjct: 17 GPGTTYSNPRRERLRWPLPPKPRLKSGGGFGPDPGSGTTVPTRRLPAPRPSFDASASEEE 76 Query: 161 EQNK 172 E+ + Sbjct: 77 EEEE 80
>RIMS1_HUMAN (Q86UR5) Regulating synaptic membrane exocytosis protein 1| (Rab3-interacting molecule 1) (RIM 1) Length = 1692 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 5 PVSGDHKPEREKKRWGFGKSFREKDPVRPPTPPVQ 109 P + H PERE+ RW D RPP+P +Q Sbjct: 1122 PDTSLHSPERERGRWS-----PSLDRRRPPSPRIQ 1151
>NFAC4_HUMAN (Q14934) Nuclear factor of activated T-cells, cytoplasmic 4| (NF-ATc4) (NFATc4) (T cell transcription factor NFAT3) (NF-AT3) Length = 902 Score = 28.1 bits (61), Expect = 8.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 14 GDHKPEREKKRWGFGKSFREKDPVR 88 G+ PE+EK R G+ FR+ P++ Sbjct: 850 GEGAPEQEKSRGGYSSGFRDSVPIQ 874 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,025,419 Number of Sequences: 219361 Number of extensions: 373026 Number of successful extensions: 1841 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1835 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)