ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet22d04 |
|---|---|
| Clone Library Name | barley_pub |
>CB26_ARATH (Q9XF89) Chlorophyll a-b binding protein CP26, chloroplast| precursor (Light-harvesting complex II protein 5) (LHCB5) (LHCIIc) Length = 280 Score = 101 bits (251), Expect = 5e-22 Identities = 54/103 (52%), Positives = 67/103 (65%) Frame = +1 Query: 94 MAALAPTKMLGTRLDFAGSSRYATAAPTAGAQKIVSLFDRFNXXXXXXXXXXXVATSSAG 273 MA+L ++MLGT L+F SR ++AP A + F+ V+ +S Sbjct: 1 MASLGVSEMLGTPLNFRAVSR--SSAPLASSPSTFKTVALFSKKKPAPAKSKAVSETS-- 56 Query: 274 IDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDP 402 DELAKWYGPDRRI+LP+GLLDRSE+PEYLNGEV GDYGYDP Sbjct: 57 --DELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDP 97
>CB23_LYCES (P27489) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type III CAB-13) Length = 265 Score = 46.6 bits (109), Expect = 1e-05 Identities = 29/80 (36%), Positives = 35/80 (43%) Frame = +1 Query: 160 ATAAPTAGAQKIVSLFDRFNXXXXXXXXXXXVATSSAGIDDELAKWYGPDRRIYLPNGLL 339 A+ A TA + +V VA SA WYGPDR YL Sbjct: 2 ASMAATASSTTVVKATPFLGQTKNANPLRDVVAMGSARFTMSNDLWYGPDRVKYLGPF-- 59 Query: 340 DRSEVPEYLNGEVPGDYGYD 399 ++ P YLNGE PGDYG+D Sbjct: 60 -SAQTPSYLNGEFPGDYGWD 78
>CB29_MAIZE (P27497) Chlorophyll a-b binding protein M9, chloroplast precursor| (LHCII type I CAB-M9) (LHCP) Length = 265 Score = 45.1 bits (105), Expect = 4e-05 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR +YL G L E P YL GE PGDYG+D Sbjct: 49 WYGPDRVLYL--GPLS-GEPPSYLTGEFPGDYGWD 80
>CB22_MAIZE (P06671) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 265 Score = 45.1 bits (105), Expect = 4e-05 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR +YL G L E P YL GE PGDYG+D Sbjct: 49 WYGPDRVLYL--GPLS-GEPPSYLTGEFPGDYGWD 80
>CB2A_PINSY (P15193) Chlorophyll a-b binding protein type 2 member 1A,| chloroplast precursor (Chlorophyll a-b binding protein type II 1A) (CAB) (LHCP) Length = 278 Score = 43.9 bits (102), Expect = 9e-05 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = +1 Query: 265 SAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 +A ID + WYGPDR +YL E P YL GE PGDYG+D Sbjct: 55 AASID---SPWYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWD 93
>CB23_HORVU (P27523) Chlorophyll a-b binding protein of LHCII type III,| chloroplast precursor (CAB) Length = 268 Score = 43.9 bits (102), Expect = 9e-05 Identities = 20/35 (57%), Positives = 23/35 (65%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL ++ P YLNGE PGDYG+D Sbjct: 50 WYGPDRVKYLGPF---SAQTPSYLNGEFPGDYGWD 81
>CB2_DUNTE (P27517) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 253 Score = 43.9 bits (102), Expect = 9e-05 Identities = 19/36 (52%), Positives = 25/36 (69%) Frame = +1 Query: 292 KWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 ++YGPDR +L G ++ PEYL GE PGDYG+D Sbjct: 32 EFYGPDRAKFL--GPFSENDTPEYLTGEFPGDYGWD 65
>CB2B_PINSY (P15194) Chlorophyll a-b binding protein type 2 member 1B,| chloroplast precursor (Chlorophyll a-b binding protein type II 1B) (CAB) (LHCP) Length = 274 Score = 43.5 bits (101), Expect = 1e-04 Identities = 20/35 (57%), Positives = 22/35 (62%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR +YL E P YL GE PGDYG+D Sbjct: 58 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWD 89
>CB2A_PYRPY (P24006) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type II CAB-1A) (LHCP) Length = 278 Score = 43.5 bits (101), Expect = 1e-04 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = +1 Query: 265 SAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 +A ID + WYGPDR +YL E P YL GE PGDYG+D Sbjct: 55 AASID---SPWYGPDRVMYLGPF---SGEPPSYLTGEFPGDYGWD 93
>CB23_APIGR (P92919) Chlorophyll a-b binding protein, chloroplast precursor| (Allergen Api g 3) Length = 264 Score = 42.7 bits (99), Expect = 2e-04 Identities = 23/47 (48%), Positives = 26/47 (55%) Frame = +1 Query: 259 TSSAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 T A + D + WYGPDR YL E P YL GE PGDYG+D Sbjct: 38 TVKAPVSD--SPWYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWD 79
>CB23_PEA (P27520) Chlorophyll a-b binding protein 215, chloroplast precursor| (LHCII type II CAB-215) (LHCP) Length = 265 Score = 42.7 bits (99), Expect = 2e-04 Identities = 19/35 (54%), Positives = 22/35 (62%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL ++P YL GE PGDYG+D Sbjct: 49 WYGPDRPKYLGPF---SEQIPSYLTGEFPGDYGWD 80
>CB21_GOSHI (P27518) Chlorophyll a-b binding protein 151, chloroplast precursor| (LHCII type II CAB-151) (LHCP) Length = 265 Score = 42.7 bits (99), Expect = 2e-04 Identities = 19/35 (54%), Positives = 22/35 (62%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL ++P YL GE PGDYG+D Sbjct: 49 WYGPDRPKYLGPF---SDQIPSYLTGEFPGDYGWD 80
>CB24_PETSP (P04782) Chlorophyll a-b binding protein 25, chloroplast precursor| (LHCII type I CAB-25) (LHCP) Length = 266 Score = 42.4 bits (98), Expect = 3e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 50 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWD 81
>CB21_PETSP (P04779) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type I CAB-13) (LHCP) Length = 266 Score = 42.4 bits (98), Expect = 3e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 50 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWD 81
>CB27_TOBAC (P27491) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCII type I CAB-7) (LHCP) Length = 267 Score = 42.4 bits (98), Expect = 3e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 51 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWD 82
>CB25_PETSP (P04783) Chlorophyll a-b binding protein 91R, chloroplast precursor| (LHCII type I CAB-91R) (LHCP) Length = 267 Score = 42.4 bits (98), Expect = 3e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 51 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWD 82
>CB22_PETSP (P04780) Chlorophyll a-b binding protein 22L, chloroplast precursor| (LHCII type I CAB-22L) (LHCP) Length = 267 Score = 42.4 bits (98), Expect = 3e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 51 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWD 82
>CB21_WHEAT (P04784) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 266 Score = 42.0 bits (97), Expect = 4e-04 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYG DR +YL G L E P YL GE PGDYG+D Sbjct: 50 WYGSDRVLYL--GPLS-GEPPSYLTGEFPGDYGWD 81
>CB21_TOBAC (P27492) Chlorophyll a-b binding protein 16, chloroplast precursor| (LHCII type I CAB-16) (LHCP) Length = 266 Score = 42.0 bits (97), Expect = 4e-04 Identities = 30/84 (35%), Positives = 36/84 (42%) Frame = +1 Query: 148 SSRYATAAPTAGAQKIVSLFDRFNXXXXXXXXXXXVATSSAGIDDELAKWYGPDRRIYLP 327 +S A ++P AG K V L + S A + WYGPDR YL Sbjct: 3 ASTTALSSPFAG--KAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLG 60 Query: 328 NGLLDRSEVPEYLNGEVPGDYGYD 399 E P YL GE PGDYG+D Sbjct: 61 PF---SGESPSYLTGEFPGDYGWD 81
>CB22_ORYSA (P12331) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 261 Score = 42.0 bits (97), Expect = 4e-04 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYG DR +YL G L E P YL GE PGDYG+D Sbjct: 45 WYGADRVLYL--GPLS-GEPPSYLTGEFPGDYGWD 76
>CB21_ORYSA (P12330) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 265 Score = 42.0 bits (97), Expect = 4e-04 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYG DR +YL G L E P YL GE PGDYG+D Sbjct: 49 WYGADRVLYL--GPLS-GEPPSYLTGEFPGDYGWD 80
>CB21_SOYBN (P12471) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 245 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 29 WYGPDRVKYLGPF---SGEPPSYLTGEFPGDYGWD 60
>CB25_NICPL (P12470) Chlorophyll a-b binding protein E, chloroplast precursor| (LHCII type I CAB-E) (LHCP) Length = 266 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 50 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWD 81
>CB21_SILPR (P12332) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 205 Score = 41.6 bits (96), Expect = 5e-04 Identities = 19/35 (54%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL + P YL GE PGDYG+D Sbjct: 48 WYGPDRPKYLGPF---SEQTPSYLTGEFPGDYGWD 79
>CB21_CUCSA (P08221) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) (Fragment) Length = 255 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 39 WYGPDRVKYLGPF---SGEPPSYLTGEFPGDYGWD 70
>CB28_PEA (P27490) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCII type I CAB-8) Length = 268 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 52 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWD 83
>CB2B_LYCES (P07370) Chlorophyll a-b binding protein 1B, chloroplast precursor| (LHCII type I CAB-1B) (LHCP) Length = 265 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 49 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWD 80
>CB22_TOBAC (P27493) Chlorophyll a-b binding protein 21, chloroplast precursor| (LHCII type I CAB-21) (LHCP) Length = 265 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 49 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWD 80
>CB21_MAIZE (P12329) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 262 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 46 WYGPDRVKYLGPF---SGEPPSYLTGEFPGDYGWD 77
>CB22_PEA (P07371) Chlorophyll a-b binding protein AB80, chloroplast| precursor (LHCII type I CAB-AB80) (LHCP) Length = 269 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 53 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWD 84
>CB22_HORVU (P08963) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 264 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 48 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWD 79
>CB23_SOYBN (P09756) Chlorophyll a-b binding protein 3, chloroplast precursor| (LHCII type I CAB-3) (LHCP) Length = 263 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 47 WYGPDRVKYLGPF---SGEPPSYLTGEFPGDYGWD 78
>CB23_ORYSA (P27519) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 263 Score = 41.6 bits (96), Expect = 5e-04 Identities = 19/35 (54%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL + P YL GE PGDYG+D Sbjct: 47 WYGPDRPKYLGPF---SEQTPSYLTGEFPGDYGWD 78
>CB2G_LYCES (P07369) Chlorophyll a-b binding protein 3C, chloroplast precursor| (LHCII type I CAB-3C) (LHCP) Length = 267 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 51 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWD 82
>CB2A_SPIOL (P12333) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 267 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 51 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWD 82
>CB25_TOBAC (P27496) Chlorophyll a-b binding protein 50, chloroplast precursor| (LHCII type I CAB-50) (LHCP) Length = 267 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 51 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWD 82
>CB24_TOBAC (P27495) Chlorophyll a-b binding protein 40, chloroplast precursor| (LHCII type I CAB-40) (LHCP) Length = 267 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE PGDYG+D Sbjct: 51 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWD 82
>CB48_MAIZE (Q00827) Chlorophyll a-b binding protein 48, chloroplast precursor| (LHCII type I CAB-48) (LHCP) Length = 264 Score = 41.2 bits (95), Expect = 6e-04 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYG DR +YL G L S P YL GE PGDYG+D Sbjct: 48 WYGADRVLYL--GPLSGSP-PSYLTGEFPGDYGWD 79
>CB2_CHLMO (P22686) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 256 Score = 40.8 bits (94), Expect = 8e-04 Identities = 22/45 (48%), Positives = 26/45 (57%) Frame = +1 Query: 265 SAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 SAGI+ WYGPDR +L + P YL GE PGDYG+D Sbjct: 34 SAGIE-----WYGPDRAKWLGPF---STNTPAYLTGEFPGDYGWD 70
>CB21_PINTH (P10049) Chlorophyll a-b binding protein type I, chloroplast| precursor (CAB) (LHCP) Length = 266 Score = 40.8 bits (94), Expect = 8e-04 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL G P YL GE PGDYG+D Sbjct: 50 WYGPDRPKYL--GPFSEG-TPSYLTGEFPGDYGWD 81
>CB23_POLMU (P15195) Chlorophyll a-b binding protein type 1 member F3,| chloroplast precursor (DE Chlorophyll a-b binding protein type I F3) (CAB-F3) (LHCP) Length = 265 Score = 40.4 bits (93), Expect = 0.001 Identities = 20/35 (57%), Positives = 23/35 (65%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYG DR +YL G S P YL+GE PGDYG+D Sbjct: 49 WYGSDRPLYL--GPFSGSP-PSYLSGEFPGDYGWD 80
>CB23_PETSP (P04781) Chlorophyll a-b binding protein 22R, chloroplast precursor| (LHCII type I CAB-22R) (LHCP) Length = 267 Score = 40.0 bits (92), Expect = 0.001 Identities = 19/35 (54%), Positives = 20/35 (57%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGPDR YL E P YL GE P DYG+D Sbjct: 51 WYGPDRVKYLGPF---SGEAPSYLTGEFPSDYGWD 82
>CB23_NICPL (P12469) Chlorophyll a-b binding protein C, chloroplast precursor| (LHCII type I CAB-C) (LHCP) Length = 267 Score = 39.7 bits (91), Expect = 0.002 Identities = 19/35 (54%), Positives = 21/35 (60%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYGP+R YL E P YL GE PGDYG+D Sbjct: 51 WYGPNRVKYLGPF---SGESPSYLTGEFPGDYGWD 82
>CB25_LYCES (P14279) Chlorophyll a-b binding protein 5, chloroplast precursor| (LHCII type I CAB-5) (LHCP) (Fragment) Length = 237 Score = 38.5 bits (88), Expect = 0.004 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYG DR YL + P YL GE PGDYG+D Sbjct: 21 WYGEDRPKYLGPF---SEQTPSYLTGEFPGDYGWD 52
>CB22_ARATH (P04778) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (CAB-140) (LHCP) Length = 267 Score = 38.5 bits (88), Expect = 0.004 Identities = 19/35 (54%), Positives = 20/35 (57%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYG DR YL E P YL GE PGDYG+D Sbjct: 50 WYGSDRVKYLGPF---SGESPSYLTGEFPGDYGWD 81
>CB21_ARATH (P04777) Chlorophyll a-b binding protein 165/180, chloroplast| precursor (LHCII type I CAB-165/180) Length = 267 Score = 38.5 bits (88), Expect = 0.004 Identities = 19/35 (54%), Positives = 20/35 (57%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYG DR YL E P YL GE PGDYG+D Sbjct: 50 WYGSDRVKYLGPF---SGESPSYLTGEFPGDYGWD 81
>CB21_SINAL (P13851) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 266 Score = 38.5 bits (88), Expect = 0.004 Identities = 19/35 (54%), Positives = 20/35 (57%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYG DR YL E P YL GE PGDYG+D Sbjct: 49 WYGSDRVKYLGPF---SGEPPSYLTGEFPGDYGWD 80
>CB26_PETSP (P12062) Chlorophyll a-b binding protein 37, chloroplast precursor| (LHCII type I CAB-37) (LHCP) Length = 265 Score = 38.5 bits (88), Expect = 0.004 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYG DR YL + P YL GE PGDYG+D Sbjct: 49 WYGEDRPKYLGPF---SEQTPSYLTGEFPGDYGWD 80
>CB24_LYCES (P14278) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCII type I CAB-4) (LHCP) Length = 265 Score = 38.5 bits (88), Expect = 0.004 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYG DR YL + P YL GE PGDYG+D Sbjct: 49 WYGEDRPKYLGPF---SEQTPSYLTGEFPGDYGWD 80
>CB23_TOBAC (P27494) Chlorophyll a-b binding protein 36, chloroplast precursor| (LHCII type I CAB-36) (LHCP) Length = 265 Score = 38.5 bits (88), Expect = 0.004 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYG DR YL + P YL GE PGDYG+D Sbjct: 49 WYGEDRPKYLGPF---SEQTPSYLTGEFPGDYGWD 80
>CB2_CHLRE (P14273) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 253 Score = 38.5 bits (88), Expect = 0.004 Identities = 20/48 (41%), Positives = 28/48 (58%) Frame = +1 Query: 256 ATSSAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 A S+G++ +YGP+R +L G + P YL GE PGDYG+D Sbjct: 28 APKSSGVE-----FYGPNRAKWL--GPYSENATPAYLTGEFPGDYGWD 68
>CB2_PHYPA (P20866) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 269 Score = 38.1 bits (87), Expect = 0.005 Identities = 22/47 (46%), Positives = 25/47 (53%) Frame = +1 Query: 259 TSSAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 + SAG D WYG DR +L E P YLNGE GDYG+D Sbjct: 43 SKSAGSD---TIWYGADRPKFLGPF---SGETPSYLNGEFAGDYGWD 83
>CB21_PEA (P04159) Chlorophyll a-b binding protein AB96 (LHCII type I| CAB-AB96) (LHCP) (Major 15) (Fragment) Length = 228 Score = 37.0 bits (84), Expect = 0.011 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 W+GPD YL E P YL GE PGDYG+D Sbjct: 12 WHGPDGVKYLGPF---SGESPSYLTGEFPGDYGWD 43
>CB21_LEMGI (P12328) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 264 Score = 37.0 bits (84), Expect = 0.011 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 WYG DR +L + P YL GE PGDYG+D Sbjct: 48 WYGADRPKFLGPF---SEQTPSYLTGEFPGDYGWD 79
>CB12_PETHY (P13869) Chlorophyll a-b binding protein, chloroplast precursor| (LHCI type II CAB) Length = 270 Score = 36.2 bits (82), Expect = 0.019 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +1 Query: 304 PDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDP 402 PDR ++ P S PE+L+G +PGD+G+DP Sbjct: 63 PDRPLWFPG-----STPPEWLDGSLPGDFGFDP 90
>CB12_LYCES (P10708) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCI type II CAB-7) Length = 270 Score = 33.9 bits (76), Expect = 0.095 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +1 Query: 304 PDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDP 402 PDR ++ P S P +L+G +PGD+G+DP Sbjct: 63 PDRPLWFPG-----STPPPWLDGSLPGDFGFDP 90
>CB4B_ARATH (Q9XF88) Chlorophyll a-b binding protein CP29.2, chloroplast| precursor (LHCII protein 4.2) (LHCB4.2) Length = 287 Score = 33.5 bits (75), Expect = 0.12 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +1 Query: 289 AKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDP 402 AK DR ++ P ++ PEYL+G + GDYG+DP Sbjct: 45 AKTVISDRPLWFPG-----AKSPEYLDGSLVGDYGFDP 77
>CB4A_LYCES (P27524) Chlorophyll a-b binding protein CP24 10A, chloroplast| precursor (CAB-10A) (LHCP) Length = 256 Score = 33.1 bits (74), Expect = 0.16 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = +1 Query: 355 PEYLNGEVPGDYGYDP 402 PE+L+G +PGDYG+DP Sbjct: 68 PEWLDGSLPGDYGFDP 83
>CB22_CUCSA (P08222) Chlorophyll a-b binding protein of LHCII type 1| (Chlorophyll a-b binding protein of LHCII type I) (CAB) (LHCP) (Fragment) Length = 206 Score = 32.0 bits (71), Expect = 0.36 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +1 Query: 349 EVPEYLNGEVPGDYGYD 399 E P YL GE PGDYG+D Sbjct: 5 EPPSYLTGEFPGDYGWD 21
>CB4B_LYCES (P27525) Chlorophyll a-b binding protein CP24 10B, chloroplast| precursor (CAB-10B) (LHCP) Length = 256 Score = 31.6 bits (70), Expect = 0.47 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = +1 Query: 355 PEYLNGEVPGDYGYDP 402 PE+L+G +PGD+G+DP Sbjct: 68 PEWLDGSLPGDFGFDP 83
>CB2_MALDO (P15773) Chlorophyll a-b binding protein AB10, chloroplast| precursor (LHCII type I CAB-AB10) (LHCP) Length = 268 Score = 31.6 bits (70), Expect = 0.47 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +1 Query: 349 EVPEYLNGEVPGDYGYD 399 E P YL GE PGDYG+D Sbjct: 68 EWPSYLTGEFPGDYGWD 84
>CB4_SPIOL (P36494) Chlorophyll a-b binding protein CP24, chloroplast| precursor Length = 261 Score = 31.6 bits (70), Expect = 0.47 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = +1 Query: 355 PEYLNGEVPGDYGYDP 402 PE+L+G +PGD+G+DP Sbjct: 73 PEWLDGSLPGDFGFDP 88
>CB29_CHLRE (Q93WD2) Chlorophyll a-b binding protein CP29| Length = 279 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +1 Query: 316 IYLPNGLLDRSEVPEYLNGEVPGDYGYDP 402 ++LPN + PE+L+G +PGD G+DP Sbjct: 51 LWLPN-----TTRPEWLDGSLPGDRGFDP 74
>UBIE_PORGI (Q7MVR7) Menaquinone biosynthesis methyltransferase ubiE (EC| 2.1.1.-) Length = 245 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = -1 Query: 396 VAVVSGNLAVEVLRHLRPVKEAVGQVDPPVRAVPLGE 286 VA +G+LA+E+ RH+ VK+ G VD + + +GE Sbjct: 65 VATGTGDLAIEICRHIPSVKQVTG-VDLSLEMMRIGE 100
>NLPD_SALTI (Q56131) Lipoprotein nlpD precursor| Length = 373 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 284 NSPSGTALTGGSTCPTASLTGRRCRSTSTA 373 N P+GT +T T PT S T STST+ Sbjct: 219 NKPAGTVVTAPVTAPTVSTTEPNASSTSTS 248
>NLPD_SALTY (P40827) Lipoprotein nlpD precursor| Length = 377 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 284 NSPSGTALTGGSTCPTASLTGRRCRSTSTA 373 N P+GT +T T PT S T STST+ Sbjct: 223 NKPAGTVVTAPVTAPTVSTTEPNASSTSTS 252
>NLPD_SALDU (P39700) Lipoprotein nlpD precursor| Length = 377 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 284 NSPSGTALTGGSTCPTASLTGRRCRSTSTA 373 N P+GT +T T PT S T STST+ Sbjct: 223 NKPAGTVVTAPVTAPTVSTTEPNASSTSTS 252
>CB4A_ARATH (Q07473) Chlorophyll a-b binding protein CP29.1, chloroplast| precursor (LHCII protein 4.1) (LHCB4.1) Length = 290 Score = 29.6 bits (65), Expect = 1.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 307 DRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDP 402 DR ++ P + P++L+G + GDYG+DP Sbjct: 54 DRPLWYPGAIS-----PDWLDGSLVGDYGFDP 80
>ALB32_ARATH (Q8L718) Inner membrane ALBINO3-like protein 2, chloroplast| precursor (Ath5) Length = 525 Score = 29.6 bits (65), Expect = 1.8 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 3 YWTHHILPSC*AEHAPLLHAPSPS 74 +++HH+ PS H+P L +PSPS Sbjct: 21 FFSHHLKPSSFISHSPPLFSPSPS 44
>INLA_LISMF (Q723K6) Internalin A precursor| Length = 800 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 284 NSPSGTALTGGSTCPTASLTGRRCRSTSTARFPETTATI 400 N+P T G +T P+A++ G +TST TT+T+ Sbjct: 716 NTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTM 754
>PTW3C_BACSU (P39816) Putative PTS system glucosamine-specific EIICBA component| [Includes: Glucosamine permease IIC component (PTS system glucosamine-specific EIIC component); Glucosamine-specific phosphotransferase enzyme IIB component (EC 2.7.1.69) (PTS Length = 631 Score = 28.9 bits (63), Expect = 3.1 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -2 Query: 194 IFCAPAVGAAVAYLEEPAKSSRVPSILVGAS 102 IFC PAV A+ + P K + +++ A+ Sbjct: 252 IFCLPAVALAIIHTARPEKKKMISGVMISAA 282
>CB13_LYCES (P27522) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCI type III CAB-8) Length = 273 Score = 28.9 bits (63), Expect = 3.1 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = +1 Query: 361 YLNGEVPGDYGYDP 402 YL+G +PGD+G+DP Sbjct: 65 YLDGRLPGDFGFDP 78
>CB22_SOYBN (P09755) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 256 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 295 WYGPDRRIYLPNGLLDRSEVPEYLNGEVPG 384 WYGPDR YL E P YL GE G Sbjct: 48 WYGPDRVKYLGP---FSGEAPSYLTGEFHG 74
>INLA_LISMO (P25146) Internalin A precursor| Length = 800 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 284 NSPSGTALTGGSTCPTASLTGRRCRSTSTARFPETTATI 400 N+P T G +T P+A++ G +TST TT+T+ Sbjct: 716 NTPPTTNNGGNTTPPSANIPGSDTSNTSTGNSASTTSTM 754
>CB11_LYCES (P12360) Chlorophyll a-b binding protein 6A, chloroplast precursor| (LHCI type I CAB-6A) (Light-harvesting complex I 26 kDa protein) Length = 246 Score = 28.5 bits (62), Expect = 4.0 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 355 PEYLNGEVPGDYGYD 399 P YL+G PGD+G+D Sbjct: 56 PSYLDGSAPGDFGFD 70
>LH18_EUGGR (P08976) Light-harvesting complex I LH38 proteins precursor| [Contains: LH38 protein 1; LH38 protein 2; LH38 protein 3] (Fragment) Length = 530 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 307 DRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDP 402 +R ++ PN + P YL GE GD G+DP Sbjct: 370 ERELWFPNIV-----PPRYLTGEAYGDKGFDP 396 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 316 IYLPNGLLDRSEVPEYLNGEVPGDYGYDP 402 ++ PN L P +LNGE GD G+DP Sbjct: 4 LWFPNTL-----APSWLNGEYYGDRGFDP 27
>C8AP2_HUMAN (Q9UKL3) CASP8-associated protein 2 (FLICE-associated huge protein)| Length = 1982 Score = 28.1 bits (61), Expect = 5.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 360 LRHLRPVKEAVGQVDPPVRAV 298 L HLRP+ EA+ ++ PVR V Sbjct: 847 LNHLRPIPEAISPLNSPVRPV 867
>NLPD_SHIFL (P0ADA4) Lipoprotein nlpD precursor| Length = 379 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 284 NSPSGTALTGGSTCPTASLTGRRCRSTSTA 373 N P+ T +T T PTAS T STST+ Sbjct: 225 NKPTATTVTAPVTVPTASTTEPTVSSTSTS 254
>NLPD_ECOLI (P0ADA3) Lipoprotein nlpD precursor| Length = 379 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 284 NSPSGTALTGGSTCPTASLTGRRCRSTSTA 373 N P+ T +T T PTAS T STST+ Sbjct: 225 NKPTATTVTAPVTVPTASTTEPTVSSTSTS 254
>CB2_DUNSA (P20865) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 273 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 292 KWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 ++YGPD +G + + P GE PGDYG+D Sbjct: 56 QFYGPDAT----SGWDLQHQHPRLPTGEFPGDYGWD 87
>YPX5_CAEEL (Q09277) Hypothetical protein F40H6.5| Length = 1216 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +2 Query: 284 NSPSGTALTGGSTCPTASLTGRRCRSTSTARFPETTAT 397 ++P TA T ST P+A+LT ST++ PET+ T Sbjct: 825 STPLETASTSQST-PSATLTSTTENIPSTSKIPETSTT 861
>CB4C_ARATH (Q9S7W1) Chlorophyll a-b binding protein CP29.3, chloroplast| precursor (LHCII protein 4.3) (LHCB4.3) Length = 276 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 307 DRRIYLPNGLLDRSEVPEYLNGEVPGDYGYDP 402 DR ++ P + PE+L+G + GD G+DP Sbjct: 55 DRLVWFPG-----ANPPEWLDGSMIGDRGFDP 81
>IL1FA_MOUSE (Q8R459) Interleukin-1 family member 10 (IL-1F10)| Length = 152 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 298 YGPDRRIYLPNGLLDRSEVPEYL 366 Y P++ LPN LDRS+VP +L Sbjct: 37 YSPEKVCILPNRGLDRSKVPIFL 59
>THTM_ECOLI (P31142) 3-mercaptopyruvate sulfurtransferase (EC 2.8.1.2)| (Rhodanese-like protein) (MST) Length = 280 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 307 DRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 D R+ P G DR+ EYLNG +PG +D Sbjct: 24 DARMASP-GQEDRNVAQEYLNGHIPGAVFFD 53
>THTM_ECO57 (P58388) 3-mercaptopyruvate sulfurtransferase (EC 2.8.1.2)| (Rhodanese-like protein) (MST) Length = 280 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 307 DRRIYLPNGLLDRSEVPEYLNGEVPGDYGYD 399 D R+ P G DR+ EYLNG +PG +D Sbjct: 24 DARMASP-GQEDRNVAQEYLNGHIPGAVFFD 53
>TGBR3_RAT (P26342) TGF-beta receptor type III precursor (TGFR-3)| (Transforming growth factor beta receptor III) (Betaglycan) Length = 853 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 5/38 (13%) Frame = +2 Query: 2 LLDPSHPPFL-----LS*ARPSAARPFSLPTLGLRQWR 100 LLDP HPP L P+ PF P + R W+ Sbjct: 379 LLDPDHPPALDNPLFPGEGSPNGGLPFPFPDIPRRGWK 416
>CB24_ARATH (P27521) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCI type III CAB-4) (LHCP) Length = 251 Score = 27.3 bits (59), Expect = 8.9 Identities = 19/64 (29%), Positives = 26/64 (40%) Frame = +1 Query: 211 RFNXXXXXXXXXXXVATSSAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPGDY 390 R N TSS ++ + +W LP GL P+YL G + GD Sbjct: 29 RLNRDLSFTSIGSSAKTSSFKVEAKKGEW--------LP-GLAS----PDYLTGSLAGDN 75 Query: 391 GYDP 402 G+DP Sbjct: 76 GFDP 79 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,443,430 Number of Sequences: 219361 Number of extensions: 712983 Number of successful extensions: 1863 Number of sequences better than 10.0: 87 Number of HSP's better than 10.0 without gapping: 1777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1822 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)
