| Clone Name | baet22c05 |
|---|---|
| Clone Library Name | barley_pub |
>RBSK_BACSU (P36945) Ribokinase (EC 2.7.1.15)| Length = 293 Score = 29.3 bits (64), Expect = 3.7 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = +2 Query: 287 NLIQDIEPLDLSVIQKDVPLETVD 358 N ++ IE +D+ +IQ+++P ETVD Sbjct: 123 NALEQIEKVDMVLIQQEIPEETVD 146
>GDF6_HUMAN (Q6KF10) Growth/differentiation factor 6 precursor (GDF-6)| (Growth/differentiation factor 16) Length = 455 Score = 29.3 bits (64), Expect = 3.7 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -1 Query: 66 AVGMWPSPAGGGRARSWLP 10 A G WP P+G AR WLP Sbjct: 309 AEGSWPPPSGAPDARPWLP 327
>GDF6_RAT (Q6HA10) Growth/differentiation factor 6 precursor (GDF-6)| (Growth/differentiation factor 16) Length = 452 Score = 29.3 bits (64), Expect = 3.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 66 AVGMWPSPAGGGRARSWLP 10 A G WP+P+G A SWLP Sbjct: 306 AEGSWPAPSGAPDAGSWLP 324
>GDF6_MOUSE (P43028) Growth/differentiation factor 6 precursor (GDF-6)| (Growth/differentiation factor 16) Length = 454 Score = 29.3 bits (64), Expect = 3.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 66 AVGMWPSPAGGGRARSWLP 10 A G WP+P+G A SWLP Sbjct: 308 AEGSWPAPSGSPDAGSWLP 326
>CARB_ARCFU (O28994) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1076 Score = 29.3 bits (64), Expect = 3.7 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 302 IEPLDLSVIQKDVPLETVDAMKRTISGMLGL 394 IEPLD ++ K + ET DA+ T+ G L Sbjct: 66 IEPLDAEIVAKIIERETPDALLPTLGGQTAL 96
>GYRA_MYCXE (P72065) DNA gyrase subunit A (EC 5.99.1.3) [Contains: Mxe gyrA| intein] (Fragment) Length = 327 Score = 28.1 bits (61), Expect = 8.3 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 254 IDGASKKSTLWNLIQDIEPLDLSVIQK 334 +D A + LW LI +I+P D +VIQ+ Sbjct: 146 VDVAGVPTLLWKLIDEIKPGDYAVIQR 172
>GYRA_MYCMA (O33149) DNA gyrase subunit A (EC 5.99.1.3) [Contains: Mma gyrA| intein] (Fragment) Length = 473 Score = 28.1 bits (61), Expect = 8.3 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 254 IDGASKKSTLWNLIQDIEPLDLSVIQKDVPLE 349 +D + LW LI++I P D V+Q+ P+E Sbjct: 130 VDVGGVPTLLWKLIEEIRPDDHVVLQRTPPVE 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,805,685 Number of Sequences: 219361 Number of extensions: 539954 Number of successful extensions: 1560 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1560 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)