| Clone Name | baet22b02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COX1_PELSU (O79672) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) ... | 28 | 5.8 |
|---|
>COX1_PELSU (O79672) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 514 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 224 YPTLLEHMGRAGAPADLAVLIAHIQAACKRIAA 322 YP L ++ AGA DLA+ H+ A + A Sbjct: 129 YPPLASNLAHAGASVDLAIFSLHLAGASSILGA 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,595,078 Number of Sequences: 219361 Number of extensions: 119822 Number of successful extensions: 461 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 461 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)