| Clone Name | baet21h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CARY_BACHD (Q9K8V7) Carbamoyl-phosphate synthase arginine-specif... | 30 | 1.1 | 2 | AA2DB_BRARE (Q8JG69) Alpha-2Db adrenergic receptor (Alpha-2Db ad... | 30 | 1.4 | 3 | MUC13_RAT (P97881) Mucin-13 precursor | 29 | 2.5 | 4 | CCL3_MOUSE (P10855) Small inducible cytokine A3 precursor (CCL3)... | 28 | 4.2 | 5 | NOTC4_HUMAN (Q99466) Neurogenic locus notch homolog protein 4 pr... | 28 | 4.2 |
|---|
>CARY_BACHD (Q9K8V7) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1047 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = -2 Query: 134 QETFLFRVSPNLARTEHVLFSFMTQQPTSTYTCIAIFGTTVLQ 6 +E ++ V+P +RT + FS T P TYT +FG T+ + Sbjct: 830 EELYVIEVNPRASRTVPI-FSKATSLPLITYTIDVLFGKTIAE 871
>AA2DB_BRARE (Q8JG69) Alpha-2Db adrenergic receptor (Alpha-2Db adrenoceptor)| (Alpha-2Db adrenoreceptor) (Alpha(2Db)AR) Length = 415 Score = 30.0 bits (66), Expect = 1.4 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 12/72 (16%) Frame = -2 Query: 185 ECLLVMNSWLYVSKSCLQETF------------LFRVSPNLARTEHVLFSFMTQQPTSTY 42 ECLL +W Y+ SC+ F ++RV+ A T V + M +QP+ + Sbjct: 178 ECLLNNETW-YILSSCIVSFFAPGLIMILVYCRIYRVAKQRASTVFVAKNGMERQPSQSE 236 Query: 41 TCIAIFGTTVLQ 6 TC G + ++ Sbjct: 237 TCFVRKGKSEVE 248
>MUC13_RAT (P97881) Mucin-13 precursor| Length = 547 Score = 29.3 bits (64), Expect = 2.5 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -1 Query: 117 PSKPQPCKDGACALQLYDSAAYIYIYLHSYLWYHSTAAC 1 P PCK A ++LYDS Y + L Y +Y+++++C Sbjct: 213 PCNSNPCKSPASCVKLYDS--YFCLCLEGY-YYNNSSSC 248
>CCL3_MOUSE (P10855) Small inducible cytokine A3 precursor (CCL3) (Macrophage| inflammatory protein 1-alpha) (MIP-1-alpha) (TY-5) (SIS-alpha) (Heparin-binding chemotaxis protein) (L2G25B) Length = 92 Score = 28.5 bits (62), Expect = 4.2 Identities = 18/58 (31%), Positives = 26/58 (44%) Frame = +1 Query: 1 ACCSTVVPKIAMQVYVDVGC*VIKLKSTCSVLARLGLTRNKKVSCKQLFDTYNHEFIT 174 ACC + KI Q VD + S CS + LT+ + C +T+ E+IT Sbjct: 33 ACCFSYSRKIPRQFIVDY----FETSSLCSQPGVIFLTKRNRQICADSKETWVQEYIT 86
>NOTC4_HUMAN (Q99466) Neurogenic locus notch homolog protein 4 precursor (Notch| 4) (hNotch4) [Contains: Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 2003 Score = 28.5 bits (62), Expect = 4.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -1 Query: 165 LMVICIKKLLARNLFVPSKPQPCKDGACALQL 70 L+++C+ + R L S P+PC +G L L Sbjct: 13 LLLLCVSVVRPRGLLCGSFPEPCANGGTCLSL 44 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,317,212 Number of Sequences: 219361 Number of extensions: 790215 Number of successful extensions: 1705 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1705 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)