| Clone Name | baet21h03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BBC1_YEAST (P47068) Myosin tail region-interacting protein MTI1 ... | 32 | 0.52 | 2 | DDX49_HUMAN (Q9Y6V7) Probable ATP-dependent RNA helicase DDX49 (... | 29 | 3.4 |
|---|
>BBC1_YEAST (P47068) Myosin tail region-interacting protein MTI1 (BBC1 protein)| Length = 1157 Score = 31.6 bits (70), Expect = 0.52 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -3 Query: 268 IKPHAPPLVRAPVNSFEFHSCERTPQAGYLTR*LQHCTGRVAQHL 134 + PH P L PV+S FH + TP+ + R H G ++ ++ Sbjct: 863 LPPHVPSLTNRPVDS--FHESDTTPKVASIRRSTTHDVGEISNNV 905
>DDX49_HUMAN (Q9Y6V7) Probable ATP-dependent RNA helicase DDX49 (EC 3.6.1.-)| (DEAD box protein 49) Length = 483 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 291 VRFFALIELNHMLHRLCGPPSIPLSFILANVPPRRDT 181 +RF + E + +L + C ++ L ILA VP RR T Sbjct: 146 IRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQT 182 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,158,241 Number of Sequences: 219361 Number of extensions: 885234 Number of successful extensions: 2026 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1997 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2025 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)