| Clone Name | baet19e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DCR2_YEAST (Q05924) Phosphatase DCR2 (EC 3.1.-.-) (Dosage-depend... | 72 | 5e-13 | 2 | SIA1_YEAST (Q12212) Protein SIA1 precursor | 54 | 2e-07 | 3 | SIA1_KLULA (Q6CPQ2) Protein SIA1 precursor | 36 | 0.050 | 4 | Y291_METJA (Q57739) Probable signal recognition particle protein... | 29 | 4.7 |
|---|
>DCR2_YEAST (Q05924) Phosphatase DCR2 (EC 3.1.-.-) (Dosage-dependent cell cycle| regulator 2) Length = 578 Score = 72.4 bits (176), Expect = 5e-13 Identities = 40/100 (40%), Positives = 54/100 (54%), Gaps = 1/100 (1%) Frame = +3 Query: 153 EDGTFKVLQVADMHYADGLSTPCEDVLPEQVPGCSDLNTTAFLYRLLRAEEPDLVVFTGD 332 ++G FK++Q+AD+H G S C D P+ +D T F+ ++L E+P LVVFTGD Sbjct: 244 DEGKFKIVQLADLHLGVGESE-CIDEYPKHEACKADPKTETFVQQVLDIEKPQLVVFTGD 302 Query: 333 NIFGN-XXXXXXXXXXXXXXPAIAMKLPWAAVLGYHDQEG 449 I G+ P IA K+PWA V G HD EG Sbjct: 303 QIMGDRSIQDSETVLLKAVAPVIARKIPWAMVWGNHDDEG 342
>SIA1_YEAST (Q12212) Protein SIA1 precursor| Length = 622 Score = 53.5 bits (127), Expect = 2e-07 Identities = 31/102 (30%), Positives = 50/102 (49%) Frame = +3 Query: 138 LRFRREDGTFKVLQVADMHYADGLSTPCEDVLPEQVPGCSDLNTTAFLYRLLRAEEPDLV 317 ++F R +FK+LQ+ D H+ C D + +++ T F+ R+L +E PDLV Sbjct: 301 IQFSRGQRSFKILQITDFHFK------CTD---NSMTVINEIKTVNFIDRVLASENPDLV 351 Query: 318 VFTGDNIFGNXXXXXXXXXXXXXXPAIAMKLPWAAVLGYHDQ 443 V TGD + + P I+ K+P+A LG D+ Sbjct: 352 VITGDLLDSHNTIDYQTCIMKVVQPMISNKIPYAISLGVSDE 393
>SIA1_KLULA (Q6CPQ2) Protein SIA1 precursor| Length = 578 Score = 35.8 bits (81), Expect = 0.050 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +3 Query: 165 FKVLQVADMHYADGLSTPCEDVLPEQVPGCSDLNTTAFLYRLLRAEEPDLVVFTG 329 FK+LQ++D+H+ + + P+ + D F++ ++R E PDL V TG Sbjct: 278 FKILQISDLHFGRHIVSDSRKEKPDSI-FRYDWPNVQFIHSVIRNERPDLAVITG 331
>Y291_METJA (Q57739) Probable signal recognition particle protein MJ0291| Length = 409 Score = 29.3 bits (64), Expect = 4.7 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +3 Query: 255 SDLNTTAFLYRLLRAEEPDLVVFTGDNIFGN 347 +++N + +++R +PDLV+F GD + GN Sbjct: 298 TNVNLMEEIKKVVRVTKPDLVIFVGDALTGN 328 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,504,882 Number of Sequences: 219361 Number of extensions: 662481 Number of successful extensions: 2483 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2480 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)