| Clone Name | baet17d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | APG_BRANA (P40603) Anter-specific proline-rich protein APG (Prot... | 43 | 2e-04 | 2 | APG_ARATH (P40602) Anter-specific proline-rich protein APG precu... | 40 | 0.002 | 3 | FUCO2_ARATH (Q9FXE5) Alpha-L-fucosidase 2 precursor (EC 3.2.1.51... | 28 | 6.8 |
|---|
>APG_BRANA (P40603) Anter-specific proline-rich protein APG (Protein CEX)| (Fragment) Length = 449 Score = 43.1 bits (100), Expect = 2e-04 Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +1 Query: 22 RLVNAVYVFGDSLVDVSNNDYLPAPAPRANRAHGMDLP-GRPTGRFTNG 165 + + AV+ FGDS+ D NN+ L R +GMD P G TGRF+NG Sbjct: 121 KTIPAVFFFGDSIFDTGNNNNLDTKLKCNYRPYGMDFPMGVATGRFSNG 169
>APG_ARATH (P40602) Anter-specific proline-rich protein APG precursor| Length = 534 Score = 40.0 bits (92), Expect = 0.002 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +1 Query: 22 RLVNAVYVFGDSLVDVSNNDYLPAPAPRANRAHGMDLPGR-PTGRFTNG 165 + + AV+ FGDS+ D NN+ L R +GMD R TGRF+NG Sbjct: 200 KTIPAVFFFGDSVFDTGNNNNLETKIKSNYRPYGMDFKFRVATGRFSNG 248
>FUCO2_ARATH (Q9FXE5) Alpha-L-fucosidase 2 precursor (EC 3.2.1.51)| (Alpha-L-fucoside fucohydrolase 2) (Alpha-1,2-fucosidase) (AtFXG1) Length = 372 Score = 28.1 bits (61), Expect = 6.8 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 34 AVYVFGDSLVDVSNNDYLPAPAPRANRAHGMDLPGRPTGRFTNG 165 A++ FGDS D L A +A HG G P GR+ +G Sbjct: 30 AIFNFGDSNSDTGG---LSAAFGQAGPPHGSSFFGSPAGRYCDG 70 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.141 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,796,128 Number of Sequences: 219361 Number of extensions: 231799 Number of successful extensions: 458 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 458 length of database: 80,573,946 effective HSP length: 31 effective length of database: 73,773,755 effective search space used: 1770570120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)