| Clone Name | baet17d02 |
|---|---|
| Clone Library Name | barley_pub |
>BAR3_CHITE (Q03376) Balbiani ring protein 3 precursor| Length = 1700 Score = 33.9 bits (76), Expect = 0.10 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +2 Query: 182 PACASKLVGCASSMNGTDAEKPPETCCGPLRDAVKNERACLC 307 P C +K + C + A +PP CGP R K + AC C Sbjct: 1532 PGCGAKKIWCQETCKCECASEPPRMGCGPNRYWDKEDCACQC 1573
>ADA32_MOUSE (Q8K410) ADAM 32 precursor (A disintegrin and metalloprotease| domain 32) Length = 750 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 227 GTDAEKPPETCCGPLRDAVKNERAC 301 G++AE P++CC P R +K RAC Sbjct: 404 GSEAECGPDSCCEPNRCVLKAGRAC 428
>KPRS2_STRMU (Q8DU94) Ribose-phosphate pyrophosphokinase 2 (EC 2.7.6.1) (RPPK 2)| (Phosphoribosyl pyrophosphate synthetase 2) (P-Rib-PP synthetase 2) (PRPP synthetase 2) Length = 326 Score = 28.1 bits (61), Expect = 5.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 77 GEALLRCHERRKVVPFFS 24 GEA++R HERR V P F+ Sbjct: 301 GEAIIRIHERRPVSPLFA 318
>NLTP_VIGUN (Q43681) Probable nonspecific lipid-transfer protein AKCS9| precursor (LTP) Length = 99 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +2 Query: 194 SKLVGCASSMNGTDAEKPPETCCGPLRDAVKNERACLCALYASPEI 331 ++L C ++ G KP TCC L K + CLC +P + Sbjct: 37 TELSSCVPAITG--GSKPSSTCCSKL----KVQEPCLCNYIKNPSL 76
>K1045_PONPY (Q5R4R7) Protein KIAA1045 homolog| Length = 400 Score = 27.3 bits (59), Expect = 9.8 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +2 Query: 233 DAEKPPETCCGPLRDAVKNERACLCALYASPEI 331 D +KPPE C P V +E +C ++ + + Sbjct: 112 DDDKPPEICLEPREPVVNDEMCDVCEVWTAESL 144
>K1045_HUMAN (Q9UPV7) Protein KIAA1045| Length = 400 Score = 27.3 bits (59), Expect = 9.8 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +2 Query: 233 DAEKPPETCCGPLRDAVKNERACLCALYASPEI 331 D +KPPE C P V +E +C ++ + + Sbjct: 112 DDDKPPEICLEPREPVVNDEMCDVCEVWTAESL 144
>MEP50_MOUSE (Q99J09) Methylosome protein 50 (MEP50 protein) (WD-repeat protein| 77) Length = 342 Score = 27.3 bits (59), Expect = 9.8 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -2 Query: 291 SFLTASLSGPQQVSGGFSASVPFMELAQPTSLD---AHAG 181 S +T SG Q VSG + +LAQ SL+ AHAG Sbjct: 129 STVTVLSSGTQAVSGSKDCCIKIWDLAQQVSLNSYRAHAG 168 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,270,784 Number of Sequences: 219361 Number of extensions: 324857 Number of successful extensions: 1111 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1080 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1111 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)