ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet17c12 |
|---|---|
| Clone Library Name | barley_pub |
>TPX2_ARATH (O22711) Peroxiredoxin TPx2 (EC 1.11.1.15) (Thioredoxin reductase)| Length = 162 Score = 77.8 bits (190), Expect = 1e-14 Identities = 35/57 (61%), Positives = 45/57 (78%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHLPGFVEK 422 GD +PD T+S+FD D +L+TV+V + AGKKV+LF VPGAFTPTCS H+PGF+ K Sbjct: 7 GDVVPDGTISFFDEND-QLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFIGK 62
>PRDX5_MOUSE (P99029) Peroxiredoxin-5, mitochondrial precursor (EC 1.11.1.15)| (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin reductase) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D-page spot 2D-0014IV) Length = 210 Score = 57.4 bits (137), Expect = 1e-08 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHLPGFVEK 422 GD +P + +P K V + +L GKK VLF VPGAFTP CS+ HLPGFVE+ Sbjct: 55 GDAIPSVEVFEGEPG----KKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQ 107
>PRDX5_HUMAN (P30044) Peroxiredoxin-5, mitochondrial precursor (EC 1.11.1.15)| (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin reductase) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) (TPx type VI) (Liver tissue 2D-page spo Length = 214 Score = 55.1 bits (131), Expect = 7e-08 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHLPGFVEK 422 GD +P + +P + V + +L GKK VLF VPGAFTP CS+ HLPGFVE+ Sbjct: 59 GDAIPAVEVFEGEPGN----KVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQ 111
>PRDX5_PAPHA (Q9GLW9) Peroxiredoxin-5, mitochondrial precursor (EC 1.11.1.15)| (Prx-V) (Thioredoxin reductase) Length = 215 Score = 55.1 bits (131), Expect = 7e-08 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHLPGFVEK 422 GD +P + +P + V + +L GKK VLF VPGAFTP CS+ HLPGFVE+ Sbjct: 60 GDAIPAVEVFEGEPGN----KVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQ 112
>PRDX5_CERAE (Q9GLW7) Peroxiredoxin-5, mitochondrial precursor (EC 1.11.1.15)| (Prx-V) (Thioredoxin reductase) Length = 215 Score = 55.1 bits (131), Expect = 7e-08 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHLPGFVEK 422 GD +P + +P + V + +L GKK VLF VPGAFTP CS+ HLPGFVE+ Sbjct: 60 GDAIPAVEVFEGEPGN----KVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQ 112
>PRDX5_RAT (Q9R063) Peroxiredoxin-5, mitochondrial precursor (EC 1.11.1.15)| (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin reductase) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) Length = 213 Score = 54.7 bits (130), Expect = 9e-08 Identities = 28/57 (49%), Positives = 35/57 (61%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHLPGFVEK 422 GD +P + +P K V + +L KK VLF VPGAFTP CS+ HLPGFVE+ Sbjct: 58 GDTIPSVEVFEGEPG----KKVNLAELFKDKKGVLFGVPGAFTPGCSKTHLPGFVEQ 110
>PRDX5_BOVIN (Q9BGI1) Peroxiredoxin-5, mitochondrial precursor (EC 1.11.1.15)| (Prx-V) (Thioredoxin reductase) Length = 219 Score = 54.3 bits (129), Expect = 1e-07 Identities = 28/57 (49%), Positives = 37/57 (64%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHLPGFVEK 422 GD +P ++ F+ G V + +L GKK VLF +PGAFTP CS+ HLPGFVE+ Sbjct: 64 GDAIP--SVEVFEKGPGN--KVNLAELFKGKKGVLFGLPGAFTPGCSKTHLPGFVEQ 116
>MALF3_MALFU (P56578) Putative peroxiredoxin (EC 1.11.1.15) (Thioredoxin| reductase) (Allergen Mal f 3) (MF2) (Fragment) Length = 166 Score = 51.2 bits (121), Expect = 1e-06 Identities = 29/66 (43%), Positives = 38/66 (57%), Gaps = 9/66 (13%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTA---------GKKVVLFAVPGAFTPTCSQKHL 404 G +P+AT +Y P EL+ V + GKKVV+ AVPGAFTPTC+ H+ Sbjct: 3 GSTIPNATFAYV-PYSPELEDHKVCGMPTSFQSHERWKGKKVVIVAVPGAFTPTCTANHV 61 Query: 405 PGFVEK 422 P +VEK Sbjct: 62 PPYVEK 67
>PMPA_CANBO (P14292) Putative peroxiredoxin-A (EC 1.11.1.15) (Thioredoxin| reductase) (Peroxisomal membrane protein A) (PMP20) (Allergen Cand b 2) Length = 166 Score = 49.3 bits (116), Expect = 4e-06 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = +3 Query: 252 GDKLPDAT-LSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHLPGFVE 419 GD+ P + Y P GE + + KK V+ +VPGAFTP C+++HLPG+++ Sbjct: 6 GDRFPTTDDVYYIPPEGGEPGPLELSKFVKTKKFVVVSVPGAFTPPCTEQHLPGYIK 62
>PMPB_CANBO (P14293) Putative peroxiredoxin-B (EC 1.11.1.15) (Thioredoxin| reductase) (Peroxisomal membrane protein B) (PMP20) (Allergen Cand b 2) Length = 166 Score = 48.9 bits (115), Expect = 5e-06 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = +3 Query: 252 GDKLPDAT-LSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHLPGFVE 419 GD+ P + Y P GE + KK V+ +VPGAFTP C+++HLPG+++ Sbjct: 6 GDRFPTTDDVYYIPPEGGEPGAFELSKFVKTKKFVVVSVPGAFTPPCTEQHLPGYIK 62
>PMP20_ASPFU (O43099) Putative peroxiredoxin pmp20 (EC 1.11.1.15) (Thioredoxin| reductase) (Peroxisomal membrane protein pmp20) (Allergen Asp f 3) Length = 168 Score = 48.5 bits (114), Expect = 6e-06 Identities = 19/29 (65%), Positives = 25/29 (86%) Frame = +3 Query: 336 AGKKVVLFAVPGAFTPTCSQKHLPGFVEK 422 A KKV+LFA+PGAFTP CS +H+P ++EK Sbjct: 44 ADKKVILFALPGAFTPVCSARHVPEYIEK 72
>Y4VD_RHISN (Q53212) Putative peroxiredoxin y4vD (EC 1.11.1.15) (Thioredoxin| reductase) Length = 188 Score = 48.1 bits (113), Expect = 8e-06 Identities = 24/52 (46%), Positives = 35/52 (67%) Frame = +3 Query: 258 KLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHLPGF 413 ++ D T+ +P E++T D +GK+VVLF++PGAFTPTCS + LP F Sbjct: 15 RVRDETIGGPNPYRWEVRTTE--DYFSGKRVVLFSLPGAFTPTCSTQQLPDF 64
>Y1621_SYNY3 (P73728) Putative peroxiredoxin sll1621 (EC 1.11.1.15) (Thioredoxin| reductase) Length = 189 Score = 47.8 bits (112), Expect = 1e-05 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = +3 Query: 318 TVGDLTAGKKVVLFAVPGAFTPTCSQKHLPGF 413 T + GKKVVLF++PGAFTPTCS HLP + Sbjct: 32 TTEQIFGGKKVVLFSLPGAFTPTCSSNHLPRY 63
>PRX5_HAEIN (P44758) Hybrid peroxiredoxin hyPrx5 (EC 1.11.1.15) (Thioredoxin| reductase) Length = 241 Score = 46.2 bits (108), Expect = 3e-05 Identities = 25/57 (43%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKT-VTVGDLTAGKKVVLFAVPGAFTPTCSQKHLPGFVE 419 G K+P T F G+ VT +L K V++F++PGAFTPTCS HLP + E Sbjct: 6 GKKVPQVT---FRTRQGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYNE 59
>PDX_ARATH (Q9M7T0) Putative peroxiredoxin, mitochondrial precursor (EC| 1.11.1.15) (Thioredoxin reductase) Length = 201 Score = 46.2 bits (108), Expect = 3e-05 Identities = 18/45 (40%), Positives = 29/45 (64%) Frame = +3 Query: 279 SYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHLPGF 413 S+ + + T + D+ GKKVV+F +PGA+T CSQ+H+P + Sbjct: 53 SWDEGVSSKFSTTPLSDIFKGKKVVIFGLPGAYTGVCSQQHVPSY 97
>MALF2_MALFU (P56577) Putative peroxiredoxin (EC 1.11.1.15) (Thioredoxin| reductase) (Allergen Mal f 2) (MF1) Length = 177 Score = 45.4 bits (106), Expect = 5e-05 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 8/65 (12%) Frame = +3 Query: 252 GDKLPDATLSYF----DPADGEL----KTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHLP 407 G+++PD + Y + GE+ T D GKKVV+ ++PGA+TP C Q+H+P Sbjct: 11 GNEIPDTLMGYIPWTPELDSGEVCGIPTTFKTRDEWKGKKVVIVSIPGAYTPICHQQHIP 70 Query: 408 GFVEK 422 V++ Sbjct: 71 PLVKR 75
>PMP20_LIPKO (Q01116) Putative peroxisomal peroxiredoxin (EC 1.11.1.15)| (Thioredoxin reductase) Length = 166 Score = 44.7 bits (104), Expect = 9e-05 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = +3 Query: 342 KKVVLFAVPGAFTPTCSQKHLPGFVEK 422 K VV+ A+PGAFTPTC+ H+P FVEK Sbjct: 41 KTVVIVAIPGAFTPTCTANHIPPFVEK 67
>YRP2_RHIET (O69777) Putative peroxiredoxin in rpoN2 3' region (EC 1.11.1.15)| (Thioredoxin reductase) Length = 179 Score = 43.1 bits (100), Expect = 3e-04 Identities = 23/52 (44%), Positives = 33/52 (63%) Frame = +3 Query: 258 KLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHLPGF 413 ++ D ++S +P E KT D +GK+V+LF++PGAFTP CS LP F Sbjct: 15 RVRDESISGPNPYRWEDKTTD--DYFSGKRVILFSLPGAFTPICSTFQLPDF 64
>AHP1_YEAST (P38013) Peroxiredoxin type-2 (EC 1.11.1.15) (Peroxiredoxin type| II) (Peroxisomal alkyl hydroperoxide reductase) (Thioredoxin peroxidase type II) (Thioredoxin reductase type II) (TPx type II) (Cytoplasmic thiol peroxidase 3) (cTPx 3) (Thiol-sp Length = 175 Score = 37.7 bits (86), Expect = 0.011 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +3 Query: 330 LTAGKKVVLFAVPGAFTPTCSQKHLPGFV 416 ++ KKV++ P AF+PTC+ H+PG++ Sbjct: 42 ISENKKVIITGAPAAFSPTCTVSHIPGYI 70
>PMP20_SCHPO (O14313) Putative peroxiredoxin pmp20 (EC 1.11.1.15) (Thioredoxin| reductase) (Peroxisomal membrane protein pmp20) Length = 156 Score = 33.1 bits (74), Expect = 0.27 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHLPGFV 416 G LP TL E K V + + K ++ VPGAFTP CS + +PG++ Sbjct: 5 GSTLPKVTL-------WENKPEEVVEFPSQGKFIIVGVPGAFTPPCSSQ-VPGYI 51
>TPX_STAAW (Q8NW51) Probable thiol peroxidase (EC 1.11.1.-)| Length = 164 Score = 30.0 bits (66), Expect = 2.3 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQK 398 GD PD T+ D +L VT+ D AGKK ++ VP T C Q+ Sbjct: 21 GDFAPDFTV-----LDNDLNQVTLADY-AGKKKLISVVPSIDTGVCDQQ 63
>TPX_STAAS (Q6G8L4) Probable thiol peroxidase (EC 1.11.1.-)| Length = 164 Score = 30.0 bits (66), Expect = 2.3 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQK 398 GD PD T+ D +L VT+ D AGKK ++ VP T C Q+ Sbjct: 21 GDFAPDFTV-----LDNDLNQVTLADY-AGKKKLISVVPSIDTGVCDQQ 63
>TPX_STAAR (Q6GFZ4) Probable thiol peroxidase (EC 1.11.1.-)| Length = 164 Score = 30.0 bits (66), Expect = 2.3 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQK 398 GD PD T+ D +L VT+ D AGKK ++ VP T C Q+ Sbjct: 21 GDFAPDFTV-----LDNDLNQVTLADY-AGKKKLISVVPSIDTGVCDQQ 63
>TPX_STAAN (P99146) Probable thiol peroxidase (EC 1.11.1.-)| Length = 164 Score = 30.0 bits (66), Expect = 2.3 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQK 398 GD PD T+ D +L VT+ D AGKK ++ VP T C Q+ Sbjct: 21 GDFAPDFTV-----LDNDLNQVTLADY-AGKKKLISVVPSIDTGVCDQQ 63
>TPX_STAAM (P66954) Probable thiol peroxidase (EC 1.11.1.-)| Length = 164 Score = 30.0 bits (66), Expect = 2.3 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQK 398 GD PD T+ D +L VT+ D AGKK ++ VP T C Q+ Sbjct: 21 GDFAPDFTV-----LDNDLNQVTLADY-AGKKKLISVVPSIDTGVCDQQ 63
>TPX_STAAC (Q5HF61) Probable thiol peroxidase (EC 1.11.1.-)| Length = 164 Score = 30.0 bits (66), Expect = 2.3 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQK 398 GD PD T+ D +L VT+ D AGKK ++ VP T C Q+ Sbjct: 21 GDFAPDFTV-----LDNDLNQVTLADY-AGKKKLISVVPSIDTGVCDQQ 63
>REHY_ORYSA (P52573) Probable peroxiredoxin (EC 1.11.1.15) (Thioredoxin| peroxidase) (RAB24 protein) Length = 220 Score = 30.0 bits (66), Expect = 2.3 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCS 392 GD +P+ L D G+++ + D V+LF+ PG FTP C+ Sbjct: 7 GDTVPNLEL---DSTHGKIR---IHDFVGDTYVILFSHPGDFTPVCT 47
>REHY_HORVU (P52572) Probable peroxiredoxin (EC 1.11.1.15) (Thioredoxin| peroxidase) (Rehydrin homolog) (B15C) Length = 218 Score = 29.6 bits (65), Expect = 3.0 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCS 392 GD +P+ L D G+++ + D V+LF+ PG FTP C+ Sbjct: 7 GDTVPNLEL---DSTHGKIR---IHDYVGNGYVILFSHPGDFTPVCT 47
>TDXH_METMP (Q6LY19) Probable peroxiredoxin (EC 1.11.1.15)| Length = 217 Score = 29.3 bits (64), Expect = 3.9 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCS 392 G+K P+ ++ G+LK + + +GK VLF+ PG FTP C+ Sbjct: 5 GEKFPEVEVT---TTHGKLK-LPEHYIESGKWFVLFSHPGDFTPVCT 47
>TDXH2_THETN (Q8R844) Probable peroxiredoxin 2 (EC 1.11.1.15)| Length = 221 Score = 29.3 bits (64), Expect = 3.9 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 339 GKKVVLFAVPGAFTPTCSQKHL 404 GK VVLF+ PG FTP C+ + + Sbjct: 40 GKWVVLFSHPGDFTPVCTTEFI 61
>RPOC2_PROMM (Q7V5P3) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1374 Score = 28.9 bits (63), Expect = 5.1 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +2 Query: 356 LRCPGRLHPDLLAEAPAGVRR 418 LR HPD+LAE PAG RR Sbjct: 1271 LRAEAGPHPDILAEDPAGYRR 1291
>RPOC2_PROMA (Q7VA30) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1367 Score = 28.9 bits (63), Expect = 5.1 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +2 Query: 356 LRCPGRLHPDLLAEAPAGVRR 418 LR HPD+LAE PAG RR Sbjct: 1263 LRAEAGPHPDILAEDPAGYRR 1283
>DXS_TROWT (Q83G46) 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7)| (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) Length = 629 Score = 28.9 bits (63), Expect = 5.1 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 294 ADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHL 404 A+ K+ +GD AG++++ F +PG F P S+ L Sbjct: 567 AEEGAKSPGLGDYIAGRRLLEFVIPGDFQPQGSRDEL 603
>DXS_TROW8 (Q83I20) 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7)| (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) Length = 629 Score = 28.9 bits (63), Expect = 5.1 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 294 ADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHL 404 A+ K+ +GD AG++++ F +PG F P S+ L Sbjct: 567 AEEGAKSPGLGDYIAGRRLLEFVIPGDFQPQGSRDEL 603
>TDXH2_SULTO (Q96XS5) Probable peroxiredoxin 2 (EC 1.11.1.15)| Length = 212 Score = 28.5 bits (62), Expect = 6.7 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +3 Query: 252 GDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCS 392 G+K P+ + G++K + D GK VLF+ PG FTP C+ Sbjct: 10 GEKFPEMEVI---TTHGKIK---LPDYYQGKWFVLFSHPGDFTPVCT 50
>VG36_BPOX2 (P07627) Tail fiber protein p36 (Protein Gp36)| Length = 216 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -1 Query: 352 TTFFPAVRSPTVTVFSSPSAGS 287 TTF AV +P++TV S+PSA S Sbjct: 126 TTFTRAVTAPSITVTSTPSAAS 147
>REHY_BROSE (P52571) Probable peroxiredoxin (EC 1.11.1.15) (Thioredoxin| peroxidase) (Rehydrin homolog) (Dormancy-associated protein PBS128) (Fragment) Length = 202 Score = 28.5 bits (62), Expect = 6.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 315 VTVGDLTAGKKVVLFAVPGAFTPTCS 392 + + D A V+LF+ PG FTP C+ Sbjct: 6 IRIHDYVANGYVILFSHPGDFTPVCT 31
>NFAT5_MOUSE (Q9WV30) Nuclear factor of activated T-cells 5 (T cell transcription| factor NFAT5) (NF-AT5) (Rel domain-containing transcription factor NFAT5) Length = 1225 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -1 Query: 373 APGTAKSTTFFPAVRSPTVTVFSSPSAGSK*ESVA 269 A G STT P V +P T+F +PS+G E+ A Sbjct: 958 ASGNETSTTTTPQVATPGSTMFQTPSSGDGEETGA 992
>JIP2_HUMAN (Q13387) C-jun-amino-terminal kinase-interacting protein 2| (JNK-interacting protein 2) (JIP-2) (JNK MAP kinase scaffold protein 2) (Islet-brain-2) (IB-2) (Mitogen-activated protein kinase 8-interacting protein 2) Length = 824 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 308 EDGDGRRPHGGEEGRALRCPGRLHPDLLAEAP 403 E+GDG GG+ G PG L P E P Sbjct: 102 EEGDGEGQEGGDPGSEAPAPGPLIPSPSVEEP 133 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,689,330 Number of Sequences: 219361 Number of extensions: 388652 Number of successful extensions: 1649 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 1636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1648 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
