| Clone Name | baet16f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CHLP_SYNY3 (Q55087) Geranylgeranyl hydrogenase | 75 | 7e-14 | 2 | BCHP_RHOCA (P26172) Geranylgeranyl hydrogenase | 36 | 0.046 | 3 | CDAN1_HUMAN (Q8IWY9) Codanin-1 | 36 | 0.046 | 4 | MCHR1_MOUSE (Q8JZL2) Melanin-concentrating hormone receptor 1 (M... | 30 | 3.3 | 5 | MPA53_PHAAQ (P56166) Major pollen allergen Pha a 5.3 precursor (... | 28 | 7.4 | 6 | DIG1_CAEEL (Q09165) Mesocentin precursor | 28 | 7.4 | 7 | MUTL_TREPA (O83325) DNA mismatch repair protein mutL | 28 | 9.7 |
|---|
>CHLP_SYNY3 (Q55087) Geranylgeranyl hydrogenase| Length = 407 Score = 75.1 bits (183), Expect = 7e-14 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +2 Query: 305 ETVLIERKMDNCKPCGGAIPLCMVSEFDLPLDLVDRRVTKMKM 433 ET L ERK+DN KPCGGAIPLCMV EFDLP +++DRRV KMKM Sbjct: 27 ETYLFERKLDNAKPCGGAIPLCMVDEFDLPPEIIDRRVRKMKM 69
>BCHP_RHOCA (P26172) Geranylgeranyl hydrogenase| Length = 391 Score = 35.8 bits (81), Expect = 0.046 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = +2 Query: 341 KPCGGAIPLCMVSEFDLPLDLVDRRVTKMKM 433 KPCGGAIP ++ +FD+P L+ ++T +M Sbjct: 38 KPCGGAIPPRLIRDFDIPDHLLVAKITSARM 68
>CDAN1_HUMAN (Q8IWY9) Codanin-1| Length = 1226 Score = 35.8 bits (81), Expect = 0.046 Identities = 20/43 (46%), Positives = 22/43 (51%), Gaps = 8/43 (18%) Frame = -2 Query: 197 PRGSRGAATSCRPPA--------APGRRKGGRWRAPWPRTRRG 93 PRGSRGA + PP AP R+GGR R P P RG Sbjct: 90 PRGSRGARSQLFPPTEAQSTAAEAPLARRGGRRRGPGPARERG 132
>MCHR1_MOUSE (Q8JZL2) Melanin-concentrating hormone receptor 1 (MCH receptor 1)| (MCHR-1) (MCH-R1) (MCH1R) (MCH-1R) (MCHR) (G-protein coupled receptor 24) (Somatostatin receptor-like protein) (SLC-1) Length = 423 Score = 29.6 bits (65), Expect = 3.3 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 6/35 (17%) Frame = -2 Query: 194 RGSRGAATSCRPP------AAPGRRKGGRWRAPWP 108 RGSRG P APG+ GGRWR P P Sbjct: 17 RGSRGCQAVEEDPFLDCGAQAPGQGGGGRWRLPQP 51
>MPA53_PHAAQ (P56166) Major pollen allergen Pha a 5.3 precursor (Pha a 5) (Clone| 29) Length = 294 Score = 28.5 bits (62), Expect = 7.4 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +1 Query: 130 PPFLLPGAAGGRQEVAAPRDPRG 198 PP +LP AAGG VAA D RG Sbjct: 268 PPQVLPLAAGGAATVAAASDSRG 290
>DIG1_CAEEL (Q09165) Mesocentin precursor| Length = 13100 Score = 28.5 bits (62), Expect = 7.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 2 APHRPSHSLAPSPPHVELEPAEELT 76 AP + LA PP V+LEP+EE+T Sbjct: 669 APFTATTWLAAKPPVVQLEPSEEMT 693
>MUTL_TREPA (O83325) DNA mismatch repair protein mutL| Length = 620 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 5 PHRPSHSLAPSPPHVELEPAEELT 76 P + +H L PSPPH+ E A + T Sbjct: 399 PVQHAHLLPPSPPHISCEHARDCT 422 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.138 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,746,011 Number of Sequences: 219361 Number of extensions: 666400 Number of successful extensions: 3317 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3314 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits)