| Clone Name | baet16d10 |
|---|---|
| Clone Library Name | barley_pub |
>3MG1_ECOLI (P05100) DNA-3-methyladenine glycosylase 1 (EC 3.2.2.20)| (DNA-3-methyladenine glycosylase I) (3-methyladenine-DNA glycosylase I, constitutive) (TAG I) (DNA-3-methyladenine glycosidase I) Length = 187 Score = 54.3 bits (129), Expect = 1e-07 Identities = 21/47 (44%), Positives = 31/47 (65%) Frame = +1 Query: 313 KRCSFITAYSDPVYVVYHDEEWGLPVHEDELLFEMLTLSGVQVGADW 453 +RC +++ DP+Y+ YHD EWG+P + + LFEM+ L G Q G W Sbjct: 2 ERCGWVS--QDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSW 46
>GUAA_HELHP (Q7VG78) Probable GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 1375 Score = 51.6 bits (122), Expect = 9e-07 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 3/52 (5%) Frame = +1 Query: 307 EEKRCSFITAYSDP---VYVVYHDEEWGLPVHEDELLFEMLTLSGVQVGADW 453 E+ RC++ T + +Y YHD EWG P+HED+ LFE L L G Q G W Sbjct: 784 EKVRCAWATDKDEAARKLYEDYHDTEWGEPLHEDKKLFEHLVLEGFQAGLSW 835
>3MGA_HAEIN (P44321) DNA-3-methyladenine glycosylase (EC 3.2.2.20)| (3-methyladenine-DNA glycosidase) (TAG) Length = 185 Score = 45.4 bits (106), Expect = 7e-05 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +1 Query: 316 RCSFITAYSDPVYVVYHDEEWGLPVHEDELLFEMLTLSGVQVGADW 453 RC ++ S +Y+ YHD+EWG P + + LFE + L G Q G W Sbjct: 4 RCPWVGEQS--IYIDYHDKEWGKPEFDSQKLFEKICLEGQQAGLSW 47
>AMP12_ENCCU (Q8SRG3) Probable M1-family aminopeptidase 2 (EC 3.4.11.-)| Length = 864 Score = 29.3 bits (64), Expect = 4.9 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 352 YVVYHDEEWGLPVHEDELLFEMLTLSGVQVGAD 450 YVV H EE L VH++ +L+ M+ +S V D Sbjct: 780 YVVSHGEELYLMVHKNAMLYNMIIMSLRHVSGD 812
>AMP11_ENCCU (Q8SQI6) Probable M1-family aminopeptidase 1 (EC 3.4.11.-)| Length = 864 Score = 29.3 bits (64), Expect = 4.9 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 352 YVVYHDEEWGLPVHEDELLFEMLTLSGVQVGAD 450 YVV H EE L VH++ +L+ M+ +S V D Sbjct: 780 YVVSHGEELYLMVHKNAMLYNMIIMSLRHVSGD 812
>ATG4_YARLI (Q6CH28) Probable cysteine protease ATG4 (EC 3.4.22.-)| (Autophagy-related protein 4) Length = 545 Score = 28.5 bits (62), Expect = 8.4 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +1 Query: 337 YSDPVYVVYHDEEWGLPVHEDELL---FEMLTLSGVQVGAD 450 + D VY++ G V+EDELL F +L L G+++G D Sbjct: 238 FPDSGLKVYYNGNGGGDVYEDELLETGFPLLVLCGLRLGID 278 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,185,437 Number of Sequences: 219361 Number of extensions: 410140 Number of successful extensions: 1387 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1387 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)