| Clone Name | baet15h07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CI041_RAT (Q5BJZ6) Protein C9orf41 homolog | 29 | 3.5 | 2 | PROQ_SHIFL (Q83RJ2) ProP effector | 28 | 4.6 | 3 | PROQ_ECOLI (P45577) ProP effector | 28 | 4.6 | 4 | PROQ_ECO57 (Q8XCM4) ProP effector | 28 | 4.6 | 5 | ABL1_HUMAN (P00519) Proto-oncogene tyrosine-protein kinase ABL1 ... | 28 | 6.0 | 6 | ABL_MLVAB (P00521) Tyrosine-protein kinase transforming protein ... | 28 | 7.8 | 7 | SSY21_ORYSA (Q7XE48) Soluble starch synthase 2-1, chloroplast pr... | 28 | 7.8 | 8 | ABL1_MOUSE (P00520) Proto-oncogene tyrosine-protein kinase ABL1 ... | 28 | 7.8 |
|---|
>CI041_RAT (Q5BJZ6) Protein C9orf41 homolog| Length = 400 Score = 28.9 bits (63), Expect = 3.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 78 GRLATCSPASPPVAGAYRREEGDERQ 155 GRL + +PA PPV G EE ER+ Sbjct: 30 GRLGSAAPAGPPVRGTAEDEERLERE 55
>PROQ_SHIFL (Q83RJ2) ProP effector| Length = 232 Score = 28.5 bits (62), Expect = 4.6 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 129 RREEGDERQPDAQLPLQKA 185 RR+EG ER+P AQ P++KA Sbjct: 147 RRKEGAERKPRAQKPVEKA 165
>PROQ_ECOLI (P45577) ProP effector| Length = 232 Score = 28.5 bits (62), Expect = 4.6 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 129 RREEGDERQPDAQLPLQKA 185 RR+EG ER+P AQ P++KA Sbjct: 147 RRKEGAERKPRAQKPVEKA 165
>PROQ_ECO57 (Q8XCM4) ProP effector| Length = 232 Score = 28.5 bits (62), Expect = 4.6 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 129 RREEGDERQPDAQLPLQKA 185 RR+EG ER+P AQ P++KA Sbjct: 147 RRKEGAERKPRAQKPVEKA 165
>ABL1_HUMAN (P00519) Proto-oncogene tyrosine-protein kinase ABL1 (EC 2.7.10.2)| (p150) (c-ABL) (Abelson murine leukemia viral oncogene homolog 1) Length = 1130 Score = 28.1 bits (61), Expect = 6.0 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = +3 Query: 39 RCKH*WQCVGRHPGRLATCSPASPPVAGAYRREEGDERQPDAQLPLQKAA 188 R KH + GR G+L+ PA PP A + G + +Q P Q+AA Sbjct: 877 RHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKAGGK---PSQSPSQEAA 923
>ABL_MLVAB (P00521) Tyrosine-protein kinase transforming protein Abl (EC| 2.7.10.2) (V-abl) Length = 746 Score = 27.7 bits (60), Expect = 7.8 Identities = 21/53 (39%), Positives = 24/53 (45%) Frame = +3 Query: 39 RCKH*WQCVGRHPGRLATCSPASPPVAGAYRREEGDERQPDAQLPLQKAA*VG 197 R KH + GR GRLA PA PP G +P AQ P Q+A G Sbjct: 494 RHKHSSESPGRDKGRLAKLKPAPPPPPAC----TGKAGKP-AQSPSQEAGEAG 541
>SSY21_ORYSA (Q7XE48) Soluble starch synthase 2-1, chloroplast precursor (EC| 2.4.1.21) (Soluble starch synthase II-1) Length = 749 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 194 RAPTPCSKRRAVATATRTCWAAPRRT 271 R P+P +RR + A R WA PRR+ Sbjct: 34 RLPSP--RRRPITAAARPTWAVPRRS 57
>ABL1_MOUSE (P00520) Proto-oncogene tyrosine-protein kinase ABL1 (EC 2.7.10.2)| (p150) (c-ABL) (Abelson murine leukemia viral oncogene homolog 1) Length = 1123 Score = 27.7 bits (60), Expect = 7.8 Identities = 21/53 (39%), Positives = 24/53 (45%) Frame = +3 Query: 39 RCKH*WQCVGRHPGRLATCSPASPPVAGAYRREEGDERQPDAQLPLQKAA*VG 197 R KH + GR GRLA PA PP G +P AQ P Q+A G Sbjct: 871 RHKHSSESPGRDKGRLAKLKPAPPPPPAC----TGKAGKP-AQSPSQEAGEAG 918 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,544,364 Number of Sequences: 219361 Number of extensions: 463308 Number of successful extensions: 1511 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1469 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1511 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)