| Clone Name | baet15e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COTO_BACSU (O31622) Spore coat protein O | 30 | 2.2 | 2 | PDZK6_HUMAN (Q9ULD6) PDZ domain-containing protein 6 | 30 | 3.7 | 3 | RAD51_YEAST (P25454) DNA repair protein RAD51 | 29 | 6.3 | 4 | UVRB_DESDG (Q30ZK3) UvrABC system protein B (Protein uvrB) (Exci... | 28 | 8.2 |
|---|
>COTO_BACSU (O31622) Spore coat protein O| Length = 227 Score = 30.4 bits (67), Expect = 2.2 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +2 Query: 227 HGSDKGRSPAPPTAMAEMPRVEMAGDGRVERLEKFSHYVARQLGFEEAS 373 H +DK APP + P +M +++ L K H + R L EA+ Sbjct: 137 HSADKAEEKAPPARKVKKPMSKMTIHEKIDFLTKLPHNMPRALCLIEAN 185
>PDZK6_HUMAN (Q9ULD6) PDZ domain-containing protein 6| Length = 942 Score = 29.6 bits (65), Expect = 3.7 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = -3 Query: 381 GHSLASSNPSCLAT*WENFSRRSTRPSPAISTLGISAMAVGGAGD 247 G S +++P+C T + ++S ++ +PSP+ S+ G GG D Sbjct: 682 GTSKVATSPTCRRTLFGDYSLKTRKPSPSCSSGGSDNGCEGGEDD 726
>RAD51_YEAST (P25454) DNA repair protein RAD51| Length = 400 Score = 28.9 bits (63), Expect = 6.3 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 332 SHYVARQLGFEEASECPQLCKAANSYLRQSSSCMADVY 445 +H +LGF++ C +LCK +S + C+ +Y Sbjct: 351 AHSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIY 388
>UVRB_DESDG (Q30ZK3) UvrABC system protein B (Protein uvrB) (Excinuclease ABC| subunit B) Length = 682 Score = 28.5 bits (62), Expect = 8.2 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 5/59 (8%) Frame = +2 Query: 215 AALCHGSDKGRSPAPPTAMAEMPRV-----EMAGDGRVERLEKFSHYVARQLGFEEASE 376 AA G +GR AP AE E G G ++RLE+ AR L FE+A+E Sbjct: 609 AAKGRGKGRGRQAAPAQTAAEDTTAYGISAEELG-GLIQRLEREMRESARDLEFEKAAE 666 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,166,717 Number of Sequences: 219361 Number of extensions: 845236 Number of successful extensions: 3202 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3202 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)