| Clone Name | baet14d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PEL1_ARATH (Q940Q1) Probable pectate lyase 1 precursor (EC 4.2.2... | 29 | 5.1 | 2 | ABCAC_HUMAN (Q86UK0) ATP-binding cassette sub-family A member 12... | 29 | 5.1 | 3 | GATB_RHILO (Q98ND3) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe... | 29 | 5.1 | 4 | UL36_HCMVA (P16767) Hypothetical protein UL36 | 29 | 6.7 |
|---|
>PEL1_ARATH (Q940Q1) Probable pectate lyase 1 precursor (EC 4.2.2.2) (Pectate| lyase A1) Length = 431 Score = 29.3 bits (64), Expect = 5.1 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = +2 Query: 140 GWDWRAIPQLLSSACIFICSGGCLGCCEKAAKHVGDLSKSLMAH 271 GW+WR+ LL + F SG A + S SL+ H Sbjct: 370 GWNWRSEGDLLQNGAYFTSSGAAASGSYARASSLSAKSSSLVGH 413
>ABCAC_HUMAN (Q86UK0) ATP-binding cassette sub-family A member 12 (ATP-binding| cassette transporter 12) (ATP-binding cassette 12) Length = 2595 Score = 29.3 bits (64), Expect = 5.1 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = +2 Query: 212 GCCE-KAAKHVGDLSKSLMAHAQNPTVAEEFWSTTTIEVDPADLRAPMNTSSWDLDLHGV 388 GC E K K G + ++M NP+ + E+ ++ IE +P DL + LHGV Sbjct: 1299 GCAEVKPEKSNGLMFTNIMMQNTNPSASPEYMFSSNIEPEPKDLTV-------GVALHGV 1351
>GATB_RHILO (Q98ND3) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B| (EC 6.3.5.-) (Asp/Glu-ADT subunit B) Length = 499 Score = 29.3 bits (64), Expect = 5.1 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = -1 Query: 437 KEKNHD*QIRPGYDCFPLHADQGPKRTCSLVLGDLPDQPRWWLYSKIPLPPWDS 276 KE+ HD + P D PL DQ + L +LPD + L + + L +D+ Sbjct: 287 KEEAHDYRYFPDPDLLPLEFDQAYVDALAKELPELPDDKKARLITSLGLSTYDA 340
>UL36_HCMVA (P16767) Hypothetical protein UL36| Length = 476 Score = 28.9 bits (63), Expect = 6.7 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -3 Query: 267 AIKLLERSPTCFAAFSQHPKQPPEQMKMQAEE 172 AI LE++PTC QHPK+ P+ M M E+ Sbjct: 303 AIVRLEKTPTC-----QHPKKTPDPMIMFDED 329 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,841,064 Number of Sequences: 219361 Number of extensions: 1272608 Number of successful extensions: 4533 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4533 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)