| Clone Name | baet14c10 |
|---|---|
| Clone Library Name | barley_pub |
>ADO_RAT (Q9Z0U5) Aldehyde oxidase (EC 1.2.3.1)| Length = 1333 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 224 CRSSRCCDEQEAEECTLTLGVQSSA 150 CR+S CC+ +E C L G+ SA Sbjct: 164 CRASGCCESKENGVCCLDQGINGSA 188
>AT5G1_RAT (Q06645) ATP synthase lipid-binding protein, mitochondrial| precursor (EC 3.6.3.14) (ATP synthase proteolipid P1) (ATPase protein 9) (ATPase subunit C) Length = 136 Score = 28.5 bits (62), Expect = 4.2 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 5/39 (12%) Frame = -1 Query: 213 PVLRRTGGRGVYLD-----LGRPEFSTKAPSCASHELQI 112 PVL R+ RG+ L RPE +K PSC S LQ+ Sbjct: 11 PVLIRSCTRGLIRPVSASLLSRPEAPSKKPSCCSSPLQV 49
>CEFE_STRCL (P18548) Deacetoxycephalosporin C synthetase (EC 1.14.20.1) (DAOCS)| (Expandase) Length = 311 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 Query: 179 TLTLGVQSSAPRHHLAPPMSCRLGRSS 99 TL G Q APRHH+A P ++ SS Sbjct: 231 TLVTGGQVKAPRHHVAAPRRDQIAGSS 257
>CYSZ_ERWCT (Q6D8S7) Protein cysZ homolog| Length = 275 Score = 27.7 bits (60), Expect = 7.2 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = +1 Query: 13 ASYTHPHTH*DLDGYRNPNSSHNQVVVVVEDRPNLQLMGGARWCLGAEL--WTPKVKVH 183 A +T H G+R + + V++ N+ LMGGA W L +L W P++ H Sbjct: 24 ADHTRSGVHYFFAGWRLISLPGIRRFVILPLLMNIVLMGGAFWWLFTQLNDWIPQIMSH 82
>ACSF1_SYNY3 (P72584) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 1 (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 1) Length = 358 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -1 Query: 198 TGGR--GVYLDLGRPEFSTKAPSCASHELQIRSI 103 T GR + LD+ PEF + +C S+ Q+R+I Sbjct: 281 TAGRVFPIILDVNNPEFYNRLETCVSNNEQLRAI 314
>AT5G1_MOUSE (P48202) ATP synthase lipid-binding protein, mitochondrial| precursor (EC 3.6.3.14) (ATP synthase proteolipid P1) (ATPase protein 9) (ATPase subunit C) Length = 136 Score = 27.3 bits (59), Expect = 9.4 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 5/39 (12%) Frame = -1 Query: 213 PVLRRTGGRGVYLD-----LGRPEFSTKAPSCASHELQI 112 P L R+ RG+ L RPE +K PSC+S LQ+ Sbjct: 11 PALIRSCTRGLIRPVSASLLSRPEAPSKQPSCSSSPLQV 49 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,750,999 Number of Sequences: 219361 Number of extensions: 698669 Number of successful extensions: 1704 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1703 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)