ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baet132e03 |
|---|---|
| Clone Library Name | barley_pub |
>FOXGB_HUMAN (P55315) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) (HFK1) Length = 477 Score = 32.3 bits (72), Expect = 0.61 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +2 Query: 101 HHHRPPPSIKHPGPRTSGKPRVIPLQPAEMPQRGG 205 HHH PPP+ + P PR + + + P P PQ GG Sbjct: 55 HHHPPPPAPQPPPPRAAQQQQ--PPPPPLAPQAGG 87
>HIS6_NATPD (Q3INY2) Imidazole glycerol phosphate synthase subunit hisF (EC| 4.1.3.-) (IGP synthase cyclase subunit) (IGP synthase subunit hisF) (ImGP synthase subunit hisF) (IGPS subunit hisF) Length = 271 Score = 31.6 bits (70), Expect = 1.0 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 117 GGRWW*DCKIHGGRVGVWSGSVEWSGE 37 G W +C I GGR G + VEW+GE Sbjct: 153 GESCWFECTIKGGREGTGTDVVEWAGE 179
>HIS6_HALSA (Q9HR52) Imidazole glycerol phosphate synthase subunit hisF (EC| 4.1.3.-) (IGP synthase cyclase subunit) (IGP synthase subunit hisF) (ImGP synthase subunit hisF) (IGPS subunit hisF) Length = 273 Score = 30.4 bits (67), Expect = 2.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 117 GGRWW*DCKIHGGRVGVWSGSVEWSGE 37 G W +C +HGGR G ++EW E Sbjct: 153 GESCWFECTVHGGREGTGMDAIEWVQE 179
>PRP3_RAT (P04474) Acidic proline-rich protein PRP33 precursor (Proline-rich| proteoglycan 1) Length = 206 Score = 30.0 bits (66), Expect = 3.0 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +2 Query: 101 HHHRPPPSIKHPGPRTSGKPRVIPLQPAEMPQRGG 205 HHH PPPS GP+TS +P P P +GG Sbjct: 94 HHHGPPPS---GGPQTSSQPG----NPQGPPPQGG 121
>ADA2A_MOUSE (Q01338) Alpha-2A adrenergic receptor (Alpha-2A adrenoceptor)| (Alpha-2A adrenoreceptor) (Alpha-2AAR) Length = 450 Score = 29.6 bits (65), Expect = 3.9 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +2 Query: 98 SHHHRPPPSIKHP--GPRTSGKPRVIPLQPAE-MPQRG 202 S H PP + P GPR GK R ++P + +P+RG Sbjct: 299 SEHAERPPGPRRPDRGPRAKGKTRASQVKPGDSLPRRG 336
>PCLO_RAT (Q9JKS6) Protein piccolo (Aczonin) (Multidomain presynaptic| cytomatrix protein) Length = 5085 Score = 29.3 bits (64), Expect = 5.1 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 113 PPPSIKHPGPRTSGKPRVIPLQPAEMPQ 196 PPP P P TS P PL PA P+ Sbjct: 2353 PPPPPPPPSPSTSSPPPTPPLPPATSPK 2380
>FOXGA_HUMAN (P55316) Forkhead box protein G1A (Forkhead-related protein FKHL2)| (Transcription factor BF-2) (Brain factor 2) (BF2) (HFK2) Length = 469 Score = 28.9 bits (63), Expect = 6.7 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 101 HHHRPPPSIKHPGPRTSGKPRVIPLQPAEMPQRGG 205 HHH PPP+ + P P +P P + A +R G Sbjct: 55 HHHPPPPAPQPPPPPQQQQPPPPPRRGARRRRRRG 89
>PHC2_MOUSE (Q9QWH1) Polyhomeotic-like protein 2 (mPH2) (Early development| regulatory protein 2) (p36) Length = 850 Score = 28.9 bits (63), Expect = 6.7 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 92 LQSHHHRPPPSIKHPGPRTSGKPRVIPLQPAEMPQ 196 LQSH P P KHP P+ + + P +PA Q Sbjct: 329 LQSHQLLPQPPAKHPQPQFVAQQQPQPPRPAPQVQ 363
>PDE4D_HUMAN (Q08499) cAMP-specific 3',5'-cyclic phosphodiesterase 4D (EC| 3.1.4.17) (DPDE3) (PDE43) Length = 809 Score = 28.9 bits (63), Expect = 6.7 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 89 ILQSHHHRPPPSIKHPGPRTSGKPRVIPLQPAEMP 193 +L HHH PPP P P+ PLQP P Sbjct: 50 LLHPHHHLPPPPPPSPQPQPQ-----CPLQPPPPP 79
>CHER1_VIBCH (Q9KQ06) Chemotaxis protein methyltransferase 1 (EC 2.1.1.80)| Length = 275 Score = 28.9 bits (63), Expect = 6.7 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = -1 Query: 432 RMVRFWSA----GQAPYQIGWTVMSA--ARTGPMWYSSLTRSDDPSNFLDAPRA 289 R ++ WSA GQ PY + T++ R G + S+T +D ++ LD RA Sbjct: 103 RPIKIWSAASSSGQEPYSMAMTILEVQQKRPGLLPSVSITATDISASMLDMCRA 156
>SF3B4_HUMAN (Q15427) Splicing factor 3B subunit 4 (Spliceosome-associated| protein 49) (SAP 49) (SF3b50) (Pre-mRNA-splicing factor SF3b 49 kDa subunit) Length = 424 Score = 28.9 bits (63), Expect = 6.7 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Frame = +2 Query: 110 RPPPSIKHPGPRTSGKPRVIPL------QPAEMPQRG 202 RPPP + HPGP G P P P MP G Sbjct: 336 RPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHG 372
>PDE4D_RAT (P14270) cAMP-specific 3',5'-cyclic phosphodiesterase 4D (EC| 3.1.4.17) (DPDE3) Length = 803 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 89 ILQSHHHRPPPSIKHPGPRTSGKPRVIPLQPAEMP 193 +L HHH PPP P P+ P PL P P Sbjct: 50 LLHPHHHLPPPPPPSPQPQLQPPPPP-PLPPPPPP 83
>ADA2A_HUMAN (P08913) Alpha-2A adrenergic receptor (Alpha-2A adrenoceptor)| (Alpha-2A adrenoreceptor) (Alpha-2AAR) (Alpha-2 adrenergic receptor subtype C10) Length = 450 Score = 28.5 bits (62), Expect = 8.7 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +2 Query: 98 SHHHRPPPSIKHP--GPRTSGKPRVIPLQPAE-MPQRG 202 S H PP + P GPR GK R ++P + +P+RG Sbjct: 299 SDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRG 336 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,602,314 Number of Sequences: 219361 Number of extensions: 836406 Number of successful extensions: 3583 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 3295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3573 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
