| Clone Name | baet125c08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CAAL_PSEPK (Q88HV0) Carboxylate-amine ligase PP3253 (EC 6.3.-.-) | 30 | 1.4 |
|---|
>CAAL_PSEPK (Q88HV0) Carboxylate-amine ligase PP3253 (EC 6.3.-.-)| Length = 368 Score = 30.4 bits (67), Expect = 1.4 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 5/43 (11%) Frame = -2 Query: 146 PWL-----LTRSS*LCPPRPLRALGWRLVLCGVWPSRGTNRVL 33 PWL L+ SS L +P L +R V+CG WP G L Sbjct: 149 PWLPLLLALSTSSPLWAGQPTGYLSYRRVICGEWPHMGLPEAL 191 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,267,424 Number of Sequences: 219361 Number of extensions: 311118 Number of successful extensions: 742 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 740 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 742 length of database: 80,573,946 effective HSP length: 27 effective length of database: 74,651,199 effective search space used: 1791628776 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)