| Clone Name | baet122d03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component... | 29 | 6.8 | 2 | 3MGH_CHLTE (Q8KBD5) Putative 3-methyladenine DNA glycosylase (EC... | 29 | 6.8 | 3 | ROM1_YEAST (P53046) RHO1 GDP-GTP exchange protein 1 (Protein kin... | 29 | 6.8 |
|---|
>COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component 1 (Low| density lipoprotein receptor defect B-complementing protein) Length = 980 Score = 28.9 bits (63), Expect = 6.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 201 SLSTIQRNHSQGNGLGGISGERRPC 275 +L T+ R H G G+G + GE + C Sbjct: 293 TLETVTRQHPTGKGIGALQGEMKLC 317
>3MGH_CHLTE (Q8KBD5) Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-)| Length = 209 Score = 28.9 bits (63), Expect = 6.8 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -3 Query: 368 WREFISLAPVRAPTYPTPLKSFHKVGLESS 279 WR+FI+ +P + T P P K GLESS Sbjct: 180 WRKFIAGSPYISKTQPGPPPKKRKKGLESS 209
>ROM1_YEAST (P53046) RHO1 GDP-GTP exchange protein 1 (Protein kinase C| suppressor SKC1) Length = 1155 Score = 28.9 bits (63), Expect = 6.8 Identities = 26/106 (24%), Positives = 41/106 (38%), Gaps = 12/106 (11%) Frame = -3 Query: 344 PVRAPTYPTPLKSFHKVGLESS--------STGSSFPADSAKPVPLAVVSLDSRQGQWES 189 P + T PTP + H + L SS ST S F +S K + + Q+ Sbjct: 172 PNQLSTPPTPKSAGHTMELHSSFNGKHSSSSTSSLFALESLKTQNRRSSNSSNHSSQYRR 231 Query: 188 R*SIHARH*LDDE----AFGYLKRVIVTPAVYPRLVEFLHFDIQST 63 + H RH + + + + TP VYP L+ + + T Sbjct: 232 HTNQHQRHHSRSKSSPVSLTEISMIKGTPLVYPALLSLIAIKFKQT 277 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,811,587 Number of Sequences: 219361 Number of extensions: 1049780 Number of successful extensions: 2465 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2465 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)