| Clone Name | baet11e07 |
|---|---|
| Clone Library Name | barley_pub |
>GP124_MOUSE (Q91ZV8) Probable G-protein coupled receptor 124 precursor (Tumor| endothelial marker 5) Length = 1329 Score = 29.3 bits (64), Expect = 4.7 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 7/50 (14%) Frame = -3 Query: 254 SSLAWFRVPCFTVLNRSLSMAPPP-------PPQGRSLARTYLVNATVPL 126 SSL W V VL++ LS PP PP R + R YL+ +PL Sbjct: 839 SSLLWMGVKA-RVLHKELSWRAPPLEEGEAAPPGPRPMLRFYLIAGGIPL 887
>TS1R1_MOUSE (Q99PG6) Taste receptor type 1 member 1 precursor (G-protein| coupled receptor 70) Length = 842 Score = 28.9 bits (63), Expect = 6.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 73 GSNKLCRECHGSARWS 26 G+N+LCRECH W+ Sbjct: 360 GTNQLCRECHAFTTWN 375
>NPAS2_MOUSE (P97460) Neuronal PAS domain protein 2 (Neuronal PAS2)| Length = 816 Score = 28.5 bits (62), Expect = 8.1 Identities = 22/57 (38%), Positives = 30/57 (52%) Frame = -3 Query: 221 TVLNRSLSMAPPPPPQGRSLARTYLVNATVPLATTVLHTAGSCELASQLWK*QALPR 51 T L R ++ P QG S A AT+P T LH++ SC+L QL Q+LP+ Sbjct: 440 TALPRPATLPQELPVQGLSQA------ATMP---TALHSSASCDLTKQLLL-QSLPQ 486
>OST3B_HUMAN (Q9Y662) Heparan sulfate glucosamine 3-O-sulfotransferase 3B1 (EC| 2.8.2.30) (Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3B1) (Heparan sulfate 3-O-sulfotransferase 3B1) (h3-OST-3B) Length = 390 Score = 28.5 bits (62), Expect = 8.1 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 227 CFTVLNRSLSMAPPPPPQGRSLARTYLVNATVPLATTVLHTAGSCELASQL 75 C V R L PPPPP R V L + AGSC A L Sbjct: 11 CLDVPGRLLPQPPPPPPPVRRKLALLFAMLCVWLYMFLYSCAGSCAAAPGL 61
>VL2_HPV38 (Q80912) Minor capsid protein L2| Length = 527 Score = 28.5 bits (62), Expect = 8.1 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -3 Query: 212 NRSLSMAPPPPPQGRSLARTYLVNATVPLATTVLHTAGSCELASQL 75 N L +A P PP +++RT N + + V+ T+G LA + Sbjct: 161 NAILEVADPHPPTRATVSRTQYNNPAFQIISEVIPTSGESSLADHV 206
>PDE4D_HUMAN (Q08499) cAMP-specific 3',5'-cyclic phosphodiesterase 4D (EC| 3.1.4.17) (DPDE3) (PDE43) Length = 809 Score = 24.6 bits (52), Expect(2) = 9.6 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = -3 Query: 332 DTNGGATTRSSVTARRCGRRHTSRWYSSLAWFRVPCFTVLNRSLSMAPPPPP 177 D+ GGAT ++ R + H R P F +L+ + PPPPP Sbjct: 19 DSAGGATLKAPKHLWRHEQHHQYP-------LRQPQFRLLHPHHHLPPPPPP 63 Score = 21.9 bits (45), Expect(2) = 9.6 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 197 MAPPPPPQGRSLARTYLVNAT 135 + PPPPP G + R AT Sbjct: 81 LPPPPPPPGAARGRYASSGAT 101 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,726,211 Number of Sequences: 219361 Number of extensions: 874570 Number of successful extensions: 3759 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3729 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)